SecReT6
Protein ID: 172062689
SecReT6 ID270
T6SS typei2
Gene symbol-
Locus tagBamMC406_3657
StrainBurkholderia ambifaria MC40-6
Repliconchromosome II [GenBank: NC_010552] [Browse all T6SS(s) in this replicon]
Location [Strand]612558..614372 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDB1Z0K3
KEGG IDbac:BamMC406_3657
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.00E-181, Aligned region: 8..602
Protein Sequence: 604 a.a.     [Download]
>gi|172062689|ref|YP_001810340.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MDNNDPILRYYEAEMRYLRESGKEFAKAHPDRARLLNLDRVGDRDPYVERLFEGFAFLTGRLQQKLDDEL
PELTEGLVSLLWPHYLRMIPSLSIVELTPFAEKLQKTVVVPAGVPVRSAPINVPAAGGAQGAAPLTVRCL
YRTTQDVALQPVSLTHAGPAVRHDGRSVIRFGFALQASALRKETDLSRLRLHLNADLPTAFAMHLALTRQ
VDAIHWRVPEIRDGESVPLPGVTIEPAGFSTEERLWPKADAAFSGYQLLLEYFTFREKFLFVDLCGLDIT
KLPEKSTRFELEIVLKDAYPSDQRFSVDNVRLFCSPVINLFELDAEPIEIDHHETEYRVVPAGHQGEHVE
TYSVDAIATFDHDTAERYEYVPFTTFRHRGGMLRHEAPERYFHTRVRSGVSGLHEMWVILGGHAWETMDT
LPEESLSLRVTGTNGLLPRKGLREASLNELAASTPNVASVRNLVSPTLPLHPPTEDRFQWRVLSHLAPNF
LSMMNAEVLRGALALYDWTNDELNRRRLAGILHVSQEMIQEVSGGAVERGVLIEVTLDAHAFSGEGDVML
FGELLHRFFGAYAEINLFTKLAIVSLPSRSRTEWPRSKAGRAPL
 
Nucleotide Sequence: 1815 bp     [Download]
>gi|172062142|ref|NC_010552.1|:612558-614372 Burkholderia ambifaria MC40-6 chromosome 2, complete sequence
ATGGACAACAACGATCCCATCCTGCGCTACTACGAAGCGGAAATGCGCTATCTGCGCGAATCCGGCAAGG
AATTCGCGAAGGCGCATCCCGATCGCGCGCGCCTGCTCAACCTCGACCGCGTCGGCGATCGCGATCCGTA
TGTCGAACGCCTGTTCGAAGGGTTTGCGTTTCTGACGGGCCGGCTCCAGCAAAAACTCGACGACGAACTG
CCCGAACTGACCGAAGGGCTCGTCAGCTTGTTGTGGCCGCACTATCTGCGGATGATTCCTTCGCTGTCGA
TCGTCGAGCTGACGCCGTTCGCGGAGAAGCTGCAGAAAACGGTAGTGGTCCCGGCCGGCGTGCCGGTGCG
CTCCGCGCCGATCAACGTGCCGGCCGCGGGCGGCGCGCAGGGCGCGGCGCCGCTGACCGTGCGATGTCTG
TACCGGACCACGCAGGATGTTGCGCTGCAGCCGGTGTCGCTCACGCATGCCGGGCCGGCCGTGCGACACG
ACGGGCGATCGGTGATCCGCTTCGGCTTCGCGTTGCAAGCGTCGGCGCTGCGCAAGGAGACGGATCTGTC
GCGGCTGCGGCTGCATTTGAACGCCGATTTGCCGACTGCATTCGCGATGCATCTTGCGCTGACGCGTCAG
GTCGACGCGATTCACTGGCGCGTTCCGGAAATACGCGATGGCGAATCCGTGCCGCTGCCGGGCGTCACGA
TCGAGCCGGCGGGATTTTCGACGGAAGAACGGCTGTGGCCCAAAGCCGATGCGGCGTTCTCCGGATATCA
GTTGCTACTTGAATACTTTACGTTTCGCGAGAAATTCCTGTTCGTCGATCTGTGCGGACTCGACATCACG
AAGCTGCCTGAAAAATCGACCCGCTTCGAACTGGAGATCGTTCTGAAGGATGCCTATCCGTCGGATCAGC
GATTCAGCGTGGACAACGTGCGACTGTTCTGTTCACCGGTGATCAACCTGTTCGAACTGGATGCCGAGCC
GATCGAGATCGACCATCACGAAACCGAGTATCGCGTCGTGCCGGCCGGTCATCAGGGCGAGCATGTCGAA
ACGTATTCGGTCGATGCGATCGCGACGTTCGATCACGATACGGCCGAGCGATACGAATACGTGCCGTTCA
CGACCTTCCGGCACCGCGGCGGCATGCTGCGGCATGAGGCGCCGGAGCGCTATTTCCACACACGCGTGCG
TTCTGGCGTATCGGGGCTGCACGAAATGTGGGTGATTCTCGGCGGGCATGCGTGGGAAACGATGGATACG
CTGCCGGAGGAAAGCCTGTCGCTGCGCGTAACGGGCACGAACGGGCTACTGCCGCGCAAGGGGCTGCGGG
AGGCAAGTCTAAACGAGCTGGCGGCCAGCACGCCGAACGTCGCGAGCGTGCGCAATCTCGTGTCGCCGAC
GTTGCCGCTCCATCCGCCGACCGAAGATCGTTTCCAGTGGCGTGTGCTGTCGCATCTCGCCCCCAACTTC
CTGTCGATGATGAACGCGGAGGTGCTGCGTGGCGCTTTGGCGCTGTACGACTGGACGAACGACGAACTGA
ACCGGCGGCGGCTCGCCGGCATCCTGCATGTCTCGCAGGAAATGATCCAGGAAGTGTCGGGCGGCGCGGT
CGAACGCGGCGTGCTGATCGAGGTCACGCTCGATGCGCATGCGTTCTCGGGCGAAGGCGACGTGATGCTG
TTCGGCGAGTTGCTGCACCGGTTCTTCGGTGCATACGCGGAGATCAATCTGTTCACGAAGCTGGCGATCG
TCAGCCTGCCATCGCGGTCGCGGACGGAGTGGCCGCGCAGCAAGGCGGGGCGGGCACCGCTATGA
 Primer design