SecReT6
Protein ID: 172062690
SecReT6 ID270
T6SS typei2
Gene symbol-
Locus tagBamMC406_3658
StrainBurkholderia ambifaria MC40-6
Repliconchromosome II [GenBank: NC_010552] [Browse all T6SS(s) in this replicon]
Location [Strand]614369..615493 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDB1Z0K4
KEGG IDbac:BamMC406_3658
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.60E-86, Aligned region: 28..343
Protein Sequence: 374 a.a.     [Download]
>gi|172062690|ref|YP_001810341.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MSASIDRMSAEAAESKGLPAVVARLFERAPKMTFMQFCRLLEACAPERPGFGTRDTPAYEPVRFRPRPRL
GFPAGEMAAVEFDDEHPDAPPTVRTTFMGLYGVDAAMPSHTIDEIALREEGHEAVEAFLDPFNHRIATLL
YRAWKKYRYPERFRAGGVDDYSQSLLCLLGFGWGDKPLRAGLPDSRMLALSGLLIQRTRTSEGLAGVVAL
AAPGAEVRVDEFWAVTTSTGRPKPLTSTKPAAGGLSDGKRNGLGGGYVLGRRLTYRSRAVRVTLRPADAR
QAQDLLPGAWLHREVMAFIQLYVGIKADVYLRMEVSSRFVPHPSVGIERTGPAPRLGWTTVLPSADERLI
DIALGAYEALPAPQPNPHLVPRTI
 
Nucleotide Sequence: 1125 bp     [Download]
>gi|172062142|ref|NC_010552.1|:614369-615493 Burkholderia ambifaria MC40-6 chromosome 2, complete sequence
ATGAGTGCATCGATCGATCGGATGAGCGCCGAAGCCGCTGAATCGAAGGGTCTGCCGGCCGTGGTTGCGA
GGCTGTTCGAGCGGGCGCCGAAGATGACTTTCATGCAGTTCTGTCGTCTTTTGGAGGCATGTGCGCCCGA
ACGTCCCGGATTCGGCACACGCGACACGCCGGCGTACGAGCCGGTGAGATTCCGGCCGCGTCCTCGGTTG
GGGTTCCCGGCAGGCGAGATGGCCGCGGTCGAATTCGACGACGAGCATCCCGATGCGCCGCCGACCGTAC
GCACGACCTTCATGGGGCTTTACGGCGTCGATGCCGCGATGCCGTCGCATACGATCGACGAGATCGCGTT
GCGCGAAGAGGGGCATGAGGCGGTGGAAGCCTTTCTCGATCCATTCAATCACCGCATCGCGACGTTGCTG
TATCGCGCATGGAAGAAGTATCGGTATCCTGAGCGTTTCCGGGCCGGTGGTGTCGACGATTATTCGCAGA
GCCTGTTGTGTCTGCTGGGGTTCGGATGGGGCGACAAGCCTTTGCGGGCAGGCCTGCCGGATTCGCGGAT
GCTCGCGTTGTCGGGGCTGCTGATCCAGCGCACGCGGACGTCCGAAGGGCTCGCCGGTGTGGTGGCGCTC
GCCGCGCCGGGGGCGGAGGTTCGCGTCGACGAGTTCTGGGCGGTGACGACGAGTACCGGTCGGCCGAAGC
CGTTGACGTCGACGAAGCCGGCTGCGGGCGGGCTGTCGGACGGCAAGCGCAACGGGCTCGGTGGCGGTTA
CGTGCTCGGCAGGCGTCTCACGTATCGCAGCCGGGCAGTGCGCGTGACGTTGCGGCCAGCCGATGCGCGG
CAGGCTCAGGATCTGCTGCCGGGCGCATGGCTGCATCGAGAGGTGATGGCATTCATCCAGCTGTATGTCG
GCATCAAGGCCGATGTGTATTTGCGGATGGAGGTGTCGTCACGGTTCGTTCCGCATCCGTCCGTCGGCAT
CGAGCGTACCGGCCCGGCGCCGCGTCTCGGCTGGACGACGGTGTTGCCGTCTGCCGACGAACGGCTGATC
GATATTGCGCTGGGTGCCTACGAGGCATTGCCGGCGCCGCAACCCAACCCGCATCTCGTGCCGCGCACGA
TCTGA
 Primer design