SecReT6
Protein ID: 172062691
SecReT6 ID270
T6SS typei2
Gene symbol-
Locus tagBamMC406_3659
StrainBurkholderia ambifaria MC40-6
Repliconchromosome II [GenBank: NC_010552] [Browse all T6SS(s) in this replicon]
Location [Strand]615507..616025 [+]
Producthypothetical protein
NoteTssJ
UniProt IDB1Z0K5
KEGG IDbac:BamMC406_3659
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.10E-40, Aligned region: 13..163
Protein Sequence: 172 a.a.     [Download]
>gi|172062691|ref|YP_001810342.1| hypothetical protein BamMC406_3659 [Burkholderia ambifaria MC40-6]
MFYRMSAATAAAVLLLSGCGAWQSVSDASSNAYRAVFFKQVKVLDVDLTARAALNPDDAGRPTSVAVRVY
QLKDRKMFDAASYDDLLKNDRTVLAQDLQANMSATVRPGASSSLSQPMQRETKYVAVVALYRVPGSAEDW
KRVVEKKRLDPDKPLRIGLTSNRLEMAGDIPK
 
Nucleotide Sequence: 519 bp     [Download]
>gi|172062142|ref|NC_010552.1|:615507-616025 Burkholderia ambifaria MC40-6 chromosome 2, complete sequence
ATGTTCTATCGAATGAGTGCGGCTACGGCTGCCGCCGTATTGCTTCTGTCGGGCTGTGGTGCGTGGCAGT
CGGTATCGGATGCGTCGTCGAATGCCTATCGCGCAGTGTTTTTCAAGCAGGTGAAGGTGCTTGACGTCGA
TCTGACTGCACGCGCGGCGCTGAACCCGGACGACGCGGGACGACCGACGTCGGTGGCCGTGCGCGTCTAC
CAGCTGAAGGATCGCAAGATGTTCGATGCCGCCTCGTACGACGATCTGTTGAAGAACGATCGCACGGTGC
TTGCCCAGGATCTGCAAGCGAATATGTCGGCTACCGTGCGCCCCGGGGCTTCGTCGAGCTTGTCTCAGCC
GATGCAACGGGAGACGAAGTATGTGGCGGTCGTTGCGTTGTACCGCGTTCCGGGAAGCGCCGAAGATTGG
AAAAGAGTCGTCGAGAAAAAGAGACTCGATCCGGACAAGCCGCTACGGATCGGATTGACGTCGAATCGGC
TTGAGATGGCAGGCGACATCCCCAAGTAA
 Primer design