SecReT6
Protein ID: 172064674
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6671
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]167500..168183 [+]
Producthypothetical protein
NoteTssL
UniProt IDB1Z6J8
KEGG IDbac:BamMC406_6671
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-19, Aligned region: 10..203
Protein Sequence: 227 a.a.     [Download]
>gi|172064674|ref|YP_001812324.1| hypothetical protein BamMC406_6671 [Burkholderia ambifaria MC40-6]
MTSDSLGVALSASLQDTVLHIALLAQGAPIPEIHVWRARCIGLVERLAQAMYDDGWESDVVRDVGLAQCA
LLDEVTFHYLPVGRRDQWMRETMLFRFHRLHSGADRIRARVDVLLNAVHPDQSLLDMYATLFELGLPHER
DEFRDRLSMARRVASSVDSSADGAWVAPTSSCATVPVGGWLSLRWGLLAVALLAGVWLAVDISLRHAVER
LPDLGAGVAHDGKEVRM
 
Nucleotide Sequence: 684 bp     [Download]
>gi|172064525|ref|NC_010553.1|:167500-168183 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGACATCCGACAGTTTAGGCGTCGCGTTGAGCGCGTCGCTGCAAGATACAGTGCTACACATCGCTTTGC
TCGCGCAGGGCGCGCCGATTCCGGAAATCCATGTTTGGCGTGCGCGTTGCATTGGGCTCGTCGAGCGACT
CGCTCAAGCGATGTACGACGACGGTTGGGAAAGCGACGTCGTGCGTGACGTCGGCCTCGCGCAATGCGCG
TTGCTGGACGAGGTCACGTTCCACTACCTACCGGTGGGCCGCCGGGACCAGTGGATGCGCGAGACAATGC
TATTCCGCTTTCATCGCCTACACAGCGGTGCGGACCGGATTCGGGCGCGAGTCGACGTGCTGTTGAACGC
GGTGCATCCAGATCAGAGTCTACTGGATATGTATGCGACCCTATTCGAGCTCGGGCTGCCGCACGAGCGC
GACGAGTTTCGAGACCGTTTGAGTATGGCGCGTCGCGTCGCATCGTCGGTCGATTCTAGTGCCGACGGCG
CGTGGGTCGCGCCGACGTCGTCGTGCGCCACCGTTCCGGTGGGCGGGTGGCTGTCGCTTCGATGGGGGCT
GCTCGCGGTGGCGCTGCTGGCGGGCGTATGGCTCGCCGTCGACATCTCGTTGCGGCATGCGGTGGAGCGC
TTGCCAGACTTGGGCGCGGGCGTCGCTCACGACGGCAAGGAGGTACGGATGTGA
 Primer design