SecReT6
Protein ID: 172064675
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6672
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]168180..169838 [+]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDB1Z6J9, B1Z6J9
KEGG IDbac:BamMC406_6672
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.60E-17, Aligned region: 347..369
OmpA [PF00691], Evalue: 4.60E-17, Aligned region: 441..538
DUF218 [PF02698], Evalue: 0.0017, Aligned region: 79..117
DUF218 [PF02698], Evalue: 0.0017, Aligned region: 446..510
Protein Sequence: 552 a.a.     [Download]
>gi|172064675|ref|YP_001812325.1| OmpA/MotB domain-containing protein [Burkholderia ambifaria MC40-6]
MNVRSMKERALVWITTPVFVFGCAWALAELGEWWSAAIVLLLVALAVCISGWYERRCATRAVGAESTDAL
GNTPRELAVIVVVGPYAASLFPRDAGRTMLRRDDRAVWLLADTPARLSSVMTQVKASRGRFPDAALLPVV
PEGDDESALRREFAHWRIALQGSYCHPECVLPCHVAVYGCLGPAEDKMPQTRWFGDPVDIDVQRVENAMR
PYDRLPAIRRQLAASRQPSAVMRSALGLAVFDWLDEAALLSSISTLANAAPFALRGVSLADVGYMSVRPG
AWTRWLIARTGLQPRITKPLTGPLPLPFVRASRPQVDARRSALLSRSRAWPLGLHVLLSSVVALTATVAI
SGWTNYRIVERIAGNLSAYRNTPGNRITAKVDSFERLRADRDEVARNLRDGVPFGAGWGLYPGRALLVRL
NAGLAGYRPPLTTVQIDSLSLFASGKATFSPEAAHRELAHALQLIQANPDQRVLIEGHADSEGSPRANIL
LSEARARAIRDWLAAKGGLSVARFAIQGLGDVRPIADNSSEAGRALNRRVDVSLFPDSTLRR
 
Nucleotide Sequence: 1659 bp     [Download]
>gi|172064525|ref|NC_010553.1|:168180-169838 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
GTGAATGTTCGATCGATGAAGGAGAGGGCGCTGGTTTGGATCACGACGCCGGTATTCGTATTCGGCTGCG
CGTGGGCACTCGCCGAGCTGGGTGAATGGTGGAGTGCAGCGATCGTTTTGCTGCTCGTCGCGTTGGCCGT
CTGCATCTCCGGCTGGTACGAGCGCCGATGCGCGACGCGTGCGGTCGGCGCCGAATCCACCGACGCACTC
GGCAACACCCCACGAGAACTCGCGGTGATCGTTGTCGTTGGGCCGTATGCCGCGAGCTTGTTTCCGCGCG
ATGCGGGACGGACTATGCTTCGGCGAGATGATCGGGCGGTGTGGCTGTTGGCCGATACGCCGGCGCGGCT
TAGCAGCGTCATGACGCAGGTAAAGGCGTCGCGGGGCCGTTTTCCGGACGCCGCGTTGCTGCCCGTGGTG
CCGGAAGGCGACGACGAAAGCGCGCTGCGCCGTGAGTTTGCACATTGGCGTATCGCGCTGCAGGGGTCGT
ACTGCCATCCGGAATGTGTGTTGCCTTGCCACGTCGCCGTGTATGGATGTTTGGGCCCCGCCGAAGATAA
GATGCCGCAGACGCGATGGTTCGGCGATCCGGTCGACATTGACGTACAGCGCGTCGAGAATGCCATGCGG
CCTTATGACCGGCTGCCGGCGATCCGTCGTCAGCTCGCGGCGTCGCGGCAGCCGAGTGCGGTGATGCGGA
GCGCGCTCGGGCTTGCGGTGTTCGATTGGCTCGACGAGGCCGCATTGTTGTCGTCTATTTCCACACTTGC
GAATGCGGCGCCGTTCGCGCTGCGCGGCGTGTCGCTGGCTGACGTCGGCTACATGTCGGTCCGGCCGGGC
GCGTGGACGCGCTGGCTCATTGCCAGAACGGGCCTGCAGCCGCGGATCACGAAGCCGCTGACGGGGCCGC
TCCCGCTGCCGTTCGTTCGCGCATCGAGGCCGCAAGTCGACGCGCGGCGTAGCGCACTGCTGTCGCGTAG
CCGCGCATGGCCGCTTGGGTTGCACGTCCTGCTGTCGAGCGTGGTAGCGCTGACCGCGACGGTGGCGATA
TCGGGCTGGACGAATTACCGGATCGTCGAGCGCATCGCGGGCAACTTGTCTGCCTACCGGAACACGCCGG
GAAACCGGATCACCGCGAAGGTCGACTCGTTCGAGCGGCTGCGCGCAGATCGCGACGAAGTAGCGCGCAA
TTTGCGCGACGGCGTGCCGTTCGGAGCGGGTTGGGGCCTGTATCCGGGACGCGCGTTGTTGGTCCGTCTC
AATGCTGGGCTTGCGGGCTACCGGCCGCCGCTAACGACTGTGCAAATCGACAGCCTTTCGCTGTTCGCAA
GTGGCAAGGCGACCTTTTCCCCGGAGGCCGCGCATCGCGAACTGGCGCATGCGCTGCAGCTGATCCAGGC
GAACCCTGACCAGCGCGTGCTAATCGAAGGACACGCCGACAGTGAAGGATCGCCTCGCGCGAATATCCTG
CTATCCGAAGCTCGCGCCCGTGCAATCCGCGATTGGCTGGCGGCCAAAGGCGGATTGTCAGTCGCCCGTT
TCGCGATCCAGGGGTTGGGCGACGTCAGGCCGATTGCGGACAACAGCAGCGAAGCCGGGCGGGCACTGAA
CCGGCGCGTTGACGTTTCCCTCTTTCCTGATAGCACCCTGCGCCGATGA
 Primer design