SecReT6
Protein ID: 172064676
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6673
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]170205..170762 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDB1Z6K0
KEGG IDbac:BamMC406_6673
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.90E-61, Aligned region: 18..171
Protein Sequence: 185 a.a.     [Download]
>gi|172064676|ref|YP_001812326.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MIKLEKLMAISNSAQKFIARNRSPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEALPAVGDRKFY
NIDIDNFDERMKAMKPRVAFSVPNTLSGTGQLMVDITFESMDDFSPAAVAKKVDALSQLLEARTQLANLQ
TYMDGKSGAENLVSQVLKDPALLNALAKAPKPEARKAAAPEPQEQ
 
Nucleotide Sequence: 558 bp     [Download]
>gi|172064525|ref|NC_010553.1|:170205-170762 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGATCAAGCTGGAGAAGCTTATGGCCATATCCAACAGTGCACAGAAATTTATTGCGCGCAATCGTTCGC
CGCGCGTCCAGATCGAGTACGACGTCGAAATTTACGGCTCGGAAAAGAAGGTGGAGTTGCCGTTTGTAAT
GGGCGTGCTCGCCGATCTGTCCGGCAAGCCGTTGGAGGCGCTTCCTGCTGTCGGCGACCGCAAGTTCTAC
AACATCGACATCGATAACTTTGATGAGCGGATGAAGGCGATGAAGCCCCGGGTGGCCTTTTCGGTGCCAA
ATACGCTGTCTGGCACCGGACAGCTGATGGTCGACATCACGTTCGAGAGCATGGACGACTTTTCGCCAGC
GGCTGTTGCGAAAAAGGTCGATGCGCTGTCGCAGCTGCTCGAAGCGCGGACGCAACTCGCGAACCTGCAG
ACCTACATGGACGGCAAGTCGGGCGCGGAGAACCTCGTTAGCCAGGTGCTGAAGGATCCGGCGTTGCTCA
ATGCGCTCGCCAAAGCGCCGAAGCCTGAAGCGCGGAAGGCGGCAGCTCCGGAACCGCAAGAGCAATAA
 Primer design