SecReT6
Protein ID: 172064677
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6674
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]170814..172313 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB1Z6K1
KEGG IDbac:BamMC406_6674
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.30E-196, Aligned region: 66..493
Protein Sequence: 499 a.a.     [Download]
>gi|172064677|ref|YP_001812327.1| EvpB family type VI secretion protein [Burkholderia ambifaria MC40-6]
MAVRESQARAAETQLSAQSDFNALLSREFKPKTEQAREAVESAVKTMAEQALSNSVTMSDDAYKSIEAII
GEIDRKLSEQINLILHHEEFQQLESAWRGLHHLVTNTETDEKLKIRFMDVSKEDLRRTMKRYKGVAWDQS
PFFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLASIGKVAAAAHAPFITGASPAVLQMDSWQELA
NPRDLTKIFTQNLEYAPWNSLRNSEDSRYIGLAMPRFLARLPYGIRTNPVDEFDFEEATDGSDHRKYTWA
NAAYAMAVNINRSFKHYGWCTLIRGVESGGVVENLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGF
IPLIHRKNTDYAAFIGAQSLQKPAEYHDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERDE
MQQWLNEWIMYYVDADPANSSQETKARRPLAAAEVVVEEVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVA
KLPSVKAAA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|172064525|ref|NC_010553.1|:170814-172313 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGGCCGTACGTGAATCGCAGGCGCGCGCTGCCGAGACGCAGCTCAGCGCGCAATCGGACTTCAACGCGC
TGCTGTCGCGCGAATTCAAGCCCAAGACAGAGCAGGCGCGCGAAGCGGTGGAGTCTGCCGTCAAGACGAT
GGCCGAGCAGGCGCTGTCGAACTCGGTGACGATGTCGGACGATGCCTATAAGAGCATCGAGGCGATCATC
GGCGAGATCGATCGTAAACTGTCGGAACAGATCAATCTTATTCTGCACCACGAAGAATTCCAGCAATTGG
AGAGCGCATGGCGCGGGCTGCATCACTTGGTGACGAACACGGAAACCGACGAGAAGCTGAAGATCCGCTT
CATGGACGTGTCGAAGGAGGATCTGCGGCGCACGATGAAACGCTACAAGGGCGTGGCGTGGGATCAGAGC
CCGTTCTTCAAGCAGATCTACGAAGAGGAATACGGTCAGTTGGGCGGCGAGCCGTACGGCTGTCTCGTCG
CGGACTATTACTTCGACCACACGCCGCCGGACGTCGATCTGTTGGCGTCGATCGGCAAGGTCGCCGCTGC
GGCGCATGCGCCGTTCATTACGGGGGCATCGCCGGCCGTGCTGCAGATGGATTCGTGGCAGGAGTTGGCA
AACCCACGTGACCTGACCAAAATCTTTACGCAGAATCTCGAGTACGCACCGTGGAACTCGCTGCGCAACT
CGGAAGACTCGCGCTACATTGGCCTCGCGATGCCGCGCTTCCTCGCGCGCCTGCCGTATGGCATTCGAAC
CAATCCGGTCGACGAATTCGATTTCGAGGAAGCGACCGACGGCTCGGATCATCGCAAGTACACGTGGGCG
AACGCGGCCTATGCGATGGCGGTCAATATCAATCGCTCGTTCAAGCACTATGGCTGGTGCACGCTGATTC
GCGGTGTTGAGAGCGGTGGTGTCGTCGAAAACCTGCCGTGCCATACGTTCCCGACCGATGACGGCGGTAT
TGACATGAAGTGCCCGACCGAGATTGCGATTTCGGACCGGCGTGAAGCGGAGCTTGCGAAGAACGGCTTC
ATTCCATTGATCCACCGCAAGAATACTGACTACGCGGCGTTCATCGGTGCGCAATCGCTGCAGAAGCCTG
CCGAATACCACGATCCGGACGCGACTGCGAACGCGAACCTCTCTGCGCGTCTGCCGTATCTGTTCGCCTG
CTCGCGTTTCGCGCACTACCTGAAGTGCATCGTGCGGGACAAGATCGGCTCGTTCAAGGAACGGGACGAA
ATGCAGCAGTGGCTCAACGAGTGGATCATGTACTACGTCGATGCCGATCCCGCGAACTCGTCGCAGGAAA
CTAAGGCCCGTCGCCCGCTCGCCGCTGCTGAGGTGGTCGTGGAAGAAGTCGAGGGCAATCCTGGCTACTA
TCAGGCCAAGTTCTTCCTGCGTCCGCATTTCCAGCTGGAAGGACTGACGGTCTCGTTGCGCCTCGTCGCG
AAGCTTCCGTCGGTAAAGGCGGCCGCTTGA
 Primer design