SecReT6
Protein ID: 172064678
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6675
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]172518..173000 [+]
Producthypothetical protein
NoteTssD
UniProt IDB1Z6K2
KEGG IDbac:BamMC406_6675
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.70E-42, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|172064678|ref|YP_001812328.1| hypothetical protein BamMC406_6675 [Burkholderia ambifaria MC40-6]
MAHDIFLKINGIDGESKDASHQNEIEILSWSWNVSQQSNMHLGSGGGAGKATVDDLQFEHYIDRASPNLI
QYCLLGKHIDEAKLTVRKAGGNPLEYILLTMNDVLVTQVSPSGVAADESRPHESVRLSFSRLKQEYVVQN
AQGGGGGAITATFDIKKNAA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|172064525|ref|NC_010553.1|:172518-173000 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGGCGCACGATATTTTCCTCAAGATCAACGGTATCGACGGCGAATCCAAGGATGCGTCGCACCAGAACG
AAATTGAGATCTTGAGCTGGTCGTGGAATGTGTCCCAGCAATCGAACATGCACCTCGGTTCGGGCGGCGG
TGCGGGCAAGGCGACTGTGGACGATCTGCAGTTCGAGCATTACATCGATCGTGCGAGCCCAAACCTGATT
CAGTACTGCCTGCTGGGCAAGCACATCGACGAAGCGAAGCTTACGGTGCGTAAGGCCGGTGGCAATCCGC
TCGAATACATCCTGCTGACGATGAACGACGTGCTTGTGACGCAGGTGAGCCCGTCTGGCGTCGCAGCCGA
CGAGTCTCGTCCCCACGAGAGCGTGCGACTGTCGTTCTCGCGCCTCAAGCAGGAATACGTCGTCCAGAAC
GCTCAAGGTGGCGGCGGCGGCGCGATCACGGCGACGTTCGACATCAAGAAGAATGCGGCTTAA
 Primer design