SecReT6
Protein ID: 172064679
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6676
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]173099..173638 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDB1Z6K3
KEGG IDbac:BamMC406_6676
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.60E-37, Aligned region: 27..169
Protein Sequence: 179 a.a.     [Download]
>gi|172064679|ref|YP_001812329.1| putative lipoprotein [Burkholderia ambifaria MC40-6]
MASRFLFGTTTRRGAIRRIAAGLSFLPMTACGSFPAPKEQASLNLKIKVSDGVNPDELGRAAPIMVRIYE
LKSAYTFDNADFFTLQSDSKKVLGEDAIVIDEFVCRPGDVRNIRRRLNPETTVIGVLAGYRDLGKSVWRG
VYRLPSPPDDVWLRVLTARLKIKLNVDVGQRAVLVTELD
 
Nucleotide Sequence: 540 bp     [Download]
>gi|172064525|ref|NC_010553.1|:173099-173638 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGGCTTCTCGATTTTTGTTCGGCACGACGACGCGCCGCGGTGCAATCAGACGCATCGCGGCCGGACTAT
CGTTTCTGCCAATGACTGCGTGTGGGAGCTTTCCGGCTCCCAAGGAGCAAGCTTCGCTGAACCTGAAGAT
TAAGGTGAGCGATGGCGTCAATCCGGACGAGCTGGGGCGAGCCGCGCCCATCATGGTGAGGATCTACGAG
TTGAAGTCGGCATACACGTTCGACAACGCCGACTTCTTCACGCTGCAAAGCGACAGCAAAAAGGTGCTCG
GCGAAGACGCGATCGTGATTGACGAGTTCGTGTGTCGCCCGGGCGACGTCCGCAACATTCGTCGTCGATT
GAATCCGGAGACCACGGTGATCGGCGTGCTCGCGGGATACCGCGATCTCGGCAAGTCAGTGTGGCGCGGG
GTTTACCGCCTGCCGTCGCCGCCGGACGACGTGTGGCTCCGGGTGCTGACAGCTCGCTTGAAAATCAAAT
TGAACGTTGATGTCGGCCAGCGGGCCGTTCTGGTTACTGAATTGGATTGA
 Primer design