SecReT6
Protein ID: 172064680
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6677
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]173642..174991 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDB1Z6K4
KEGG IDbac:BamMC406_6677
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-138, Aligned region: 20..447
Protein Sequence: 449 a.a.     [Download]
>gi|172064680|ref|YP_001812330.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MSWFNKVVWSEGLFLLPQLFQQQERYFEHFAHKRAAPLSSFFWGFSQFDIDQESLAFGKLVFKSGTGIFP
DGTPFDVPAHVPPPPPLTIAPEHQNQLIYVAVPLRLPNTEETAFRDQTGSLARYRAFENELRDSNAIGQG
PKPVQLANLRLRLLPEKELTQSWIGIALTRIKALRVDGSVSLHDTDHIPPVSQYGADPLLREWATQLHGL
AKLRADALATRLSGSDGRAGAAAEVADYLLLQVLNRYEPLLEHICRIRETPPVEFYRELAVMAGELSTFV
RPQTRRPLPTPGYDHAQLFGSIRPLVEEVHYLLNQVLIRGAQPIPLTEQPHGIRVAAVMPAELSGYSSLV
LAVGAQMSPDVLQQQFASQTKISQPQRLPELIRSHLPGLTVVPLPVPPRQIPFNSSYIYYELSRSGPFWE
QIAQQGGLAMHIAGHFPELKVELWGVRHK
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|172064525|ref|NC_010553.1|:173642-174991 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGAGTTGGTTTAACAAGGTCGTGTGGAGCGAAGGTCTTTTCCTGCTTCCCCAGCTGTTTCAGCAGCAAG
AGCGCTATTTTGAACATTTCGCGCACAAGCGCGCGGCGCCGCTGAGCTCGTTCTTCTGGGGATTCAGCCA
GTTCGACATCGATCAGGAGTCGCTTGCGTTCGGCAAGCTTGTGTTCAAGAGCGGAACCGGCATATTTCCG
GACGGCACGCCGTTTGATGTGCCGGCGCACGTACCGCCGCCGCCGCCGCTGACGATCGCGCCCGAGCATC
AGAACCAGTTGATCTATGTGGCCGTCCCGCTGCGTCTGCCCAATACGGAGGAGACCGCGTTTCGCGATCA
GACGGGTTCGCTCGCCCGTTACAGGGCTTTCGAAAATGAGCTTCGGGACAGTAATGCGATCGGCCAGGGC
CCGAAGCCCGTGCAACTGGCGAACCTGCGCTTGCGGCTTTTGCCCGAGAAAGAGTTGACGCAGTCGTGGA
TCGGCATCGCGCTGACGCGCATTAAGGCATTGCGTGTAGACGGTTCGGTGTCGCTGCACGACACTGATCA
CATTCCACCGGTCAGCCAATATGGCGCCGATCCGCTGCTGCGGGAGTGGGCCACTCAGTTGCACGGCCTC
GCGAAGCTGCGCGCCGATGCGCTTGCCACTCGTCTGTCCGGTAGCGACGGGCGTGCTGGGGCGGCGGCGG
AAGTGGCCGATTACCTGTTGTTGCAGGTACTGAATCGCTACGAGCCGCTGCTTGAACATATTTGCCGGAT
TCGCGAGACGCCGCCCGTGGAGTTCTATCGTGAACTCGCGGTGATGGCCGGCGAACTGTCGACGTTCGTG
CGTCCTCAGACGCGGCGTCCGTTACCGACGCCGGGCTACGATCACGCGCAGTTGTTTGGGAGCATCCGGC
CGCTCGTCGAGGAAGTACATTACCTGCTCAACCAAGTACTGATACGTGGTGCACAGCCGATTCCGCTAAC
CGAGCAGCCACACGGCATCCGCGTCGCTGCTGTGATGCCGGCCGAACTCTCGGGCTATTCGAGTCTCGTG
CTCGCGGTCGGCGCGCAGATGTCGCCGGACGTGCTCCAGCAGCAATTCGCGTCGCAGACGAAGATCAGCC
AGCCGCAGCGTCTGCCCGAACTGATCCGCTCGCATCTACCGGGCCTCACGGTGGTGCCGTTGCCGGTTCC
GCCGCGACAGATTCCATTCAATTCGAGCTACATCTACTACGAGCTGTCGCGGAGTGGCCCGTTCTGGGAG
CAGATCGCGCAACAGGGCGGGCTTGCGATGCACATCGCAGGCCACTTCCCGGAACTGAAGGTCGAACTGT
GGGGAGTCCGTCATAAATGA
 Primer design