SecReT6
Protein ID: 172064681
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6678
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]174988..176298 [+]
Producthypothetical protein
NoteTssL
UniProt IDB1Z6K5
KEGG IDbac:BamMC406_6678
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.10E-62, Aligned region: 63..269
OmpA [PF00691], Evalue: 2.70E-14, Aligned region: 328..426
Protein Sequence: 436 a.a.     [Download]
>gi|172064681|ref|YP_001812331.1| DotU family type IV/VI secretion system protein [Burkholderia ambifaria MC40-6]
MSSGTFDKDAFDFLSGDSGALREPQREGRADRRGAPRPLADTGEFDATENIQQRLDEVFAAENPLLEAAR
PLLRMLADMPATLDTSEAVDDLRTLLVLEVNLFQKVCDRADLPWKHMAVVRYCLCTALDEAANRTNWGGG
GVWATRGLLITFEGEVDGGEKFFLLIGRMATDPQEYVDILEIMYRVLGLGFEGRYSVVADGRRYLEQIRQ
RLWTLITGARDALQPELSTHWRGAEAGRLPLLRSVPVWATAACALLALFALFVFYQYHLLSERHVLEARI
LDIGKDRLVSAPQRLRLSYLLRNEVARGLLTVDEDDRRSVVVFKGDSMFASGQSTVLPVVEPALGKVGGE
VARVGGSVLVRGHTDNQPIRSAVFPSNLVLSEKRAAYVAQILQQRGTPADRIHAIGKGDTQPVGDNATAA
GRALNRRVEIVVTQQR
 
Nucleotide Sequence: 1311 bp     [Download]
>gi|172064525|ref|NC_010553.1|:174988-176298 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGAGCTCGGGTACGTTCGATAAAGATGCGTTCGACTTTCTGTCGGGCGATTCCGGCGCGTTGCGCGAGC
CTCAGAGGGAAGGCAGGGCTGACAGAAGGGGCGCGCCGCGCCCGCTGGCCGACACAGGCGAGTTTGACGC
GACCGAGAATATTCAGCAGCGTCTCGACGAGGTGTTCGCCGCTGAAAATCCGCTGCTTGAGGCGGCGCGG
CCGTTGCTCAGAATGCTCGCCGACATGCCGGCCACGCTCGACACGTCTGAGGCGGTGGACGACCTGCGGA
CGCTGCTCGTGCTCGAGGTCAACCTGTTCCAGAAAGTGTGCGATCGGGCCGATCTGCCGTGGAAGCACAT
GGCGGTCGTGCGATATTGCCTTTGTACCGCGCTTGATGAGGCGGCCAATCGCACGAACTGGGGCGGGGGC
GGCGTATGGGCGACGCGGGGTCTGCTGATCACGTTCGAGGGGGAAGTCGACGGCGGTGAGAAGTTCTTCC
TGCTGATTGGCCGGATGGCGACTGATCCACAGGAGTACGTCGATATCCTCGAAATCATGTATCGCGTCCT
AGGTCTCGGATTTGAAGGGCGCTACAGCGTGGTGGCCGACGGACGTCGCTATCTGGAACAAATTCGCCAG
CGTCTGTGGACGCTCATCACCGGCGCGCGCGATGCGCTTCAGCCGGAGTTGTCGACGCACTGGCGAGGCG
CGGAGGCCGGCAGGCTGCCCCTGTTGCGCAGTGTGCCGGTCTGGGCCACGGCCGCCTGTGCGCTGCTCGC
GCTGTTTGCGCTGTTCGTGTTTTACCAGTACCACCTGCTGTCGGAGCGCCATGTACTGGAAGCGCGGATT
CTCGATATTGGCAAGGACAGGCTGGTGTCGGCGCCGCAGCGCCTGCGCCTGTCGTACCTGTTGAGGAACG
AGGTCGCCCGCGGCCTGTTGACTGTGGACGAGGATGACCGGCGCAGCGTCGTCGTGTTCAAGGGCGATTC
GATGTTTGCGTCGGGCCAGAGCACGGTGCTTCCGGTGGTCGAGCCGGCGTTGGGCAAGGTTGGCGGCGAG
GTGGCGCGCGTCGGTGGCAGCGTGCTAGTGAGAGGGCATACGGACAATCAGCCGATCCGCAGCGCGGTCT
TCCCGAGCAATCTCGTCCTGTCGGAAAAGCGCGCAGCGTATGTCGCGCAGATTCTTCAGCAGCGTGGTAC
GCCCGCGGATCGCATTCATGCGATCGGCAAGGGCGATACCCAGCCGGTTGGCGACAACGCCACGGCAGCT
GGCCGGGCACTTAATCGCCGCGTGGAAATCGTGGTTACGCAGCAACGCTGA
 Primer design