SecReT6
Protein ID: 172064682
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6679
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]176307..180215 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB1Z6K6
KEGG IDbac:BamMC406_6679
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.20E-92, Aligned region: 262..540
IcmF-related [PF06761], Evalue: 3.30E-90, Aligned region: 440..467
IcmF-related [PF06761], Evalue: 3.30E-90, Aligned region: 590..913
DUF1215 [PF06744], Evalue: 3.00E-30, Aligned region: 439..468
DUF1215 [PF06744], Evalue: 3.00E-30, Aligned region: 1036..1159
SRP54 [PF00448], Evalue: 0.0033, Aligned region: 192..206
SRP54 [PF00448], Evalue: 0.0033, Aligned region: 239..268
Protein Sequence: 1302 a.a.     [Download]
>gi|172064682|ref|YP_001812332.1| type VI secretion protein IcmF [Burkholderia ambifaria MC40-6]
MSYLKRLYYWIFSRRMLACVAVLLACVAVWFLGPLFVFGDLHPFAGDAIRVIAIALLMGWLVLRLLRWPS
SPIWVIALCVALWHVGPLFGMGERHPVEPIWVRVLLIATIVFCYAAYGLYMLWQALRTNDALLTRFLQPK
TDKPIEAGRDEIHAVAMVVSKAIAQLKRLRGGTLGWRRLLEVDRHLYGLPWYMMVGTAGAGKTTAILGSG
LQFPLTEQMSALSAQGIERTVNCEWWFANEAVLIDTAGRYLEQDDPQNEMAKTINAAEWKELLGQLRKHR
PRAPLNGAILAVSVADLVSRSEAERTALAANLRARIGELRQQLGVRFPVYVFVTKLDMLAGFTEYFQSLT
AEGRTQIWGFTLPCNESGTSSVAELRRHCARELTLLEARVDAGLNNRLLEEYEGDRRKRLYPLAHEFRSL
SVQLTDLLELVFLDSRYDDAQLQHMLRGVYFTSAEQTDQVIAADRETVLQRLRRKLARIRGNSDAAAQVR
GEGAVSGRRSYFLRNVFQHVIVPEAHLVRADLKWEIRFRLMRWAGHVLTLTLFVWLVFSLTVSYENNHAY
LTAISAKASALAARAAAYGKSPKPAAIGGLLDGSRDLPRYRDLDLDAPGGAYRYGLYVVPAIVEASDETY
LSLLKQTLLPQIARRAESALSTQLGEQNPDDVYRTLSIYLMLYDDSRYDAKAVKAWVLRDWERSDSAAEM
GGRKAMARHLDALFVDGRPVKPTVAPDAALVQRARLFLSQNSAPKRLYERAIGVMEKEAPENFTLSQALG
LQGASLFKLVDGSRFEQGVPGLYTYDGYHALFNQRLPEFLARAQEDDDWVMGRAGTRSDWTKSIQGMRVV
TAKSSLAEDIRRQYLIDYGNYWQRFLADIRPAMSGENGRDGTLALDLATLRALAAPDSPLVRLARAVVRE
TSLSVVDTQEPTSLNDLALTTVGRKSSTVKAAAVEARKIAAQRPEQRLEKELVDNRFAALREVTTGQADT
GSGPAMTDKPVAAGGKALQLDAVLTLINEQYTRLVVANNALSANSMPPALDIGTTLQTEAEKLPAPLMLV
LGGIATQVADKVGQEVGGLLVMQVDTSVGQGCRRTIDGKYPFTRSSQEVDVEDFNRMFSAGGVFDEFFQK
SLASYVDTNSKPWRYKSLSPGMPPIKGPSLEPFERAAAIRELFFRDQGAKRMAWKMNAKVASIDPEITEL
LIDIDGQTQRYLHGPVSPFPLSWPGPRGGAIAEVAAKPAIRPDTSTIVATGPWALFRLIERGRLTGTASA
SRLTLDFDFDGRHAALELMTGGQLNPLTNDLLTGFHCPGGLA
 
Nucleotide Sequence: 3909 bp     [Download]
>gi|172064525|ref|NC_010553.1|:176307-180215 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGTCTTATTTGAAACGTCTTTACTATTGGATCTTTTCTCGGCGGATGTTGGCTTGCGTGGCAGTCCTGC
TGGCGTGCGTCGCAGTTTGGTTCCTGGGGCCGTTGTTCGTGTTTGGCGACTTGCATCCATTCGCCGGCGA
CGCGATCCGGGTGATCGCGATCGCGCTGCTCATGGGCTGGCTCGTTTTGCGCCTGCTAAGATGGCCGTCA
AGCCCGATCTGGGTGATTGCACTTTGCGTCGCGCTCTGGCACGTGGGGCCGCTTTTCGGGATGGGCGAGC
GTCATCCTGTCGAGCCGATCTGGGTACGGGTCCTGCTGATTGCGACGATCGTTTTCTGCTACGCAGCCTA
CGGCCTGTACATGTTGTGGCAGGCATTGCGGACGAACGACGCGTTGCTGACGCGCTTTCTCCAGCCGAAG
ACGGACAAGCCGATCGAAGCCGGGCGCGACGAGATCCACGCGGTCGCCATGGTGGTGTCCAAGGCGATCG
CTCAACTGAAGCGTCTGCGTGGCGGCACGCTGGGTTGGCGTCGTTTGCTTGAGGTCGACCGGCACCTGTA
CGGGTTGCCGTGGTACATGATGGTCGGCACAGCGGGGGCCGGGAAGACCACGGCGATCCTCGGTTCGGGC
CTGCAATTTCCGCTGACCGAGCAGATGAGTGCGCTGTCCGCTCAGGGCATCGAACGCACCGTGAACTGCG
AATGGTGGTTCGCGAACGAGGCGGTGCTAATAGATACCGCGGGTCGCTACCTCGAGCAGGACGATCCGCA
GAACGAAATGGCCAAGACCATCAACGCGGCGGAATGGAAGGAACTGCTCGGTCAGTTGCGCAAGCATCGG
CCCCGGGCGCCGCTCAACGGCGCGATCCTGGCGGTCAGCGTCGCTGACCTGGTAAGCCGGTCGGAAGCCG
AACGCACCGCACTCGCCGCGAACTTGCGCGCTCGAATCGGCGAACTTCGGCAGCAGCTCGGGGTTCGTTT
CCCGGTATACGTGTTTGTGACGAAGCTGGACATGCTGGCGGGCTTCACGGAGTATTTCCAGTCGCTGACC
GCGGAAGGGCGCACCCAGATCTGGGGGTTCACGCTGCCCTGCAACGAGTCGGGCACATCAAGCGTCGCGG
AGCTACGGCGTCACTGCGCGCGCGAGCTGACGTTGCTCGAGGCGCGGGTCGATGCTGGCTTGAACAACCG
CTTGCTGGAGGAATACGAGGGCGACCGCCGCAAGCGGCTGTACCCGCTGGCGCACGAATTCCGCAGCTTG
TCGGTGCAGCTCACGGATCTGCTCGAGCTGGTGTTCCTCGATTCCCGCTACGACGACGCGCAACTCCAGC
ACATGCTGCGGGGCGTGTATTTCACGAGCGCGGAGCAGACGGACCAGGTGATCGCCGCGGATCGCGAGAC
GGTGTTGCAGCGGCTGAGGCGCAAGCTGGCGCGCATACGCGGGAATAGCGATGCGGCGGCGCAGGTGCGC
GGCGAGGGGGCGGTGTCGGGGCGTCGGAGCTACTTCCTGCGCAACGTGTTCCAGCATGTGATCGTGCCGG
AAGCGCATCTGGTTCGTGCGGATCTGAAGTGGGAGATTCGCTTTAGATTAATGCGCTGGGCCGGTCATGT
GCTGACCTTGACCCTGTTCGTCTGGCTCGTATTCTCGCTCACGGTGAGCTACGAGAACAACCATGCGTAT
CTGACCGCGATTTCCGCCAAGGCGTCGGCGCTGGCTGCGCGTGCCGCGGCCTACGGCAAGTCTCCGAAGC
CGGCCGCAATCGGCGGTTTGCTGGACGGCTCGAGAGATCTGCCGCGTTATCGCGATCTTGATCTCGACGC
GCCGGGCGGCGCGTACCGCTACGGCCTCTATGTCGTTCCGGCGATCGTCGAGGCGTCGGACGAGACCTAT
CTGAGTCTGCTGAAACAGACCTTGCTGCCGCAGATCGCGCGGCGCGCCGAAAGCGCGCTGAGCACGCAGC
TTGGCGAGCAAAACCCGGACGACGTCTACCGGACGCTGTCCATCTACCTGATGCTGTACGACGACAGCCG
TTACGATGCAAAGGCCGTGAAAGCCTGGGTGTTGCGCGACTGGGAGCGTTCGGACAGTGCGGCGGAGATG
GGCGGTCGCAAAGCGATGGCGCGGCATCTGGATGCGCTATTCGTCGACGGGCGTCCCGTCAAGCCGACGG
TGGCGCCGGACGCGGCGCTCGTGCAGCGGGCGCGGCTCTTCCTGAGCCAGAACTCTGCGCCGAAGCGGCT
TTACGAGCGGGCGATCGGCGTGATGGAGAAGGAGGCACCCGAAAACTTCACGCTCTCGCAGGCGCTCGGG
TTGCAAGGCGCGTCGCTCTTTAAGCTGGTGGACGGATCGCGCTTCGAGCAGGGCGTTCCGGGACTCTACA
CGTACGATGGCTATCACGCGCTGTTCAATCAGCGCCTGCCGGAATTCCTCGCGCGTGCGCAGGAAGACGA
CGATTGGGTCATGGGGCGCGCCGGCACGCGTTCCGACTGGACGAAGTCGATACAAGGCATGCGCGTCGTG
ACGGCGAAATCATCGCTCGCCGAGGACATTCGCCGCCAGTATCTGATTGATTACGGCAACTATTGGCAGC
GGTTTCTCGCAGACATCCGGCCGGCCATGAGCGGCGAGAATGGCCGTGACGGCACGCTGGCTCTCGATCT
GGCGACGCTGCGCGCGCTCGCCGCGCCAGACTCGCCGCTGGTGCGGCTGGCGCGGGCGGTTGTCCGGGAA
ACGTCGTTGTCGGTCGTCGATACGCAAGAGCCCACGTCGCTGAACGATCTCGCGCTGACGACGGTGGGCC
GCAAGTCCTCCACGGTAAAGGCCGCGGCGGTCGAGGCGCGGAAGATCGCCGCGCAGCGGCCGGAACAGCG
GCTCGAGAAAGAACTCGTCGACAACCGTTTCGCGGCGCTGCGCGAGGTCACCACCGGTCAGGCGGACACC
GGCAGTGGCCCGGCGATGACGGACAAGCCCGTTGCGGCGGGCGGAAAGGCGTTACAACTCGACGCAGTCC
TGACGCTGATCAACGAGCAGTACACGCGACTCGTCGTTGCGAACAACGCGTTGTCGGCCAACAGCATGCC
GCCCGCCCTCGATATCGGCACGACGTTGCAGACCGAGGCCGAAAAACTTCCGGCGCCGCTGATGCTCGTG
CTCGGAGGGATCGCGACGCAGGTGGCGGACAAGGTCGGGCAGGAGGTCGGAGGGCTGCTCGTGATGCAGG
TCGATACGAGCGTCGGGCAGGGCTGTCGGCGCACGATCGACGGAAAATATCCGTTCACACGCAGCAGCCA
GGAAGTGGACGTCGAGGACTTCAACAGGATGTTCTCAGCCGGCGGTGTATTCGACGAATTCTTCCAGAAA
TCGCTCGCGAGCTACGTCGACACAAACTCCAAGCCGTGGCGCTACAAGTCGTTGAGTCCCGGCATGCCGC
CGATCAAGGGGCCGAGTCTCGAGCCGTTCGAACGCGCTGCCGCGATCCGTGAACTGTTTTTCCGCGATCA
GGGTGCCAAGCGGATGGCTTGGAAGATGAACGCCAAGGTGGCGTCCATCGATCCGGAGATTACCGAATTG
CTGATCGACATTGACGGTCAGACGCAACGTTACCTGCATGGGCCTGTCTCGCCGTTCCCGCTTAGCTGGC
CGGGACCGCGCGGCGGCGCGATAGCCGAGGTCGCGGCCAAGCCCGCGATCCGGCCGGATACGTCGACGAT
CGTCGCGACCGGACCGTGGGCGCTGTTTCGATTGATCGAACGAGGTCGGCTGACTGGCACCGCGTCAGCC
AGCCGCTTGACGCTGGATTTCGATTTCGATGGCCGGCATGCGGCGCTGGAGTTGATGACGGGCGGTCAGT
TGAATCCGCTGACGAACGATCTGCTGACGGGCTTTCATTGTCCGGGAGGTCTCGCGTGA
 Primer design