SecReT6
Protein ID: 172064685
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6682
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]181653..184826 [+]
Producttype VI secretion system Vgr family protein
NoteTssI
UniProt IDB1Z6K9
KEGG IDbac:BamMC406_6682
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.50E-83, Aligned region: 41..367
Phage_base_V [PF04717], Evalue: 2.10E-25, Aligned region: 408..501
Protein Sequence: 1057 a.a.     [Download]
>gi|172064685|ref|YP_001812335.1| type VI secretion system Vgr family protein [Burkholderia ambifaria MC40-6]
MSMNSLEGRLHQERTVTISSDAMPRLLGQPALRFLSLRGEEHLGKLYTYEVLLRTPDDFHVPLSSSANLD
LKAMIGTEMTVSIQLDGIGTGAERGVGAGGREISGLVVKAGFLRTEGRYNVYRIVLRPWLWLATLTNDYK
IFQDKTVVEIIDTVLSDYPYPVDKRLDIDKYTVQGESERNEPRAFQVQYGETDFDFIQRLMEEWGIYWFF
EHSDSKHRLVLCDHIGAHRRSSSAAYHEIAHHPEGGKTDIEYLNYFSTDESLRPGRVVIDDFDFTRPRAQ
LVTSNHQPRETNWGEGELFEWPGDYTDSKHGDLISRVRMEERRAPGTRAFGKGNVRGVACGQTFTLTKHK
HDDANREYIVIEAALMMTEIADETGSGYHYECNNELIVQPTSEVFRMPRETPKPTTSGPQSAIVVGPPGH
EVWTDEFGRVKVRFMWDRYARNDATDSCWVRVSQAWAGVNFGGIYIPRIGQEVIVGFMNGDPDRPLILGS
LYNTVTPPPWDLPGDATKSGFKSKSIKGGRENYNGIRFEDKPGVEEFHMQAERDMNRLTKSSESHTVGVN
FSIGVGLAHNRAVGGMFSSIVGGAASYAVGGAESTIVGGASALNVGGAYAIAVGGPMSTSVGGAYALTVG
GALSIVCGAAAINMTADGTIKLVGTKIKVVGSDEVVIQGSPLQLNPGREDGAGGGGGGAIPPIPVPLFFR
SITVPILPPLPPPPALPPAPSSEPPPPSSEPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSS
EPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSS
EPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSS
EPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSS
EPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSSEPPPPSE
EPPPSEF
 
Nucleotide Sequence: 3174 bp     [Download]
>gi|172064525|ref|NC_010553.1|:181653-184826 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGTCAATGAACTCTTTGGAAGGACGGCTCCATCAGGAGCGTACGGTGACGATCAGCAGCGACGCAATGC
CGCGGCTGCTTGGTCAACCCGCGCTCCGGTTCCTGTCGCTTCGCGGTGAAGAACACCTGGGGAAGCTTTA
TACGTATGAGGTCCTGTTGCGTACGCCGGACGATTTTCACGTTCCGTTGTCGAGCAGTGCGAACCTCGAT
CTGAAGGCAATGATCGGAACGGAGATGACCGTCAGCATACAGCTTGACGGCATCGGCACAGGCGCGGAGC
GCGGTGTCGGCGCAGGCGGTCGCGAGATCAGCGGTCTGGTCGTGAAGGCGGGCTTCCTGCGGACCGAGGG
ACGCTACAACGTCTACCGGATCGTGTTGAGGCCGTGGCTCTGGCTAGCGACGCTGACGAACGACTACAAG
ATCTTTCAGGACAAAACGGTTGTCGAGATCATCGACACCGTGTTGAGCGATTATCCGTACCCGGTCGACA
AACGGCTCGACATCGACAAGTACACGGTGCAAGGCGAGAGCGAGCGCAACGAGCCGCGTGCGTTCCAGGT
GCAGTACGGCGAGACGGATTTCGACTTCATCCAGCGCTTGATGGAGGAGTGGGGGATCTACTGGTTCTTC
GAGCACTCCGATAGCAAGCACCGGCTCGTGCTGTGCGATCACATTGGGGCGCATCGCCGTTCGAGCAGTG
CTGCTTATCACGAAATCGCGCATCACCCGGAAGGCGGCAAGACCGACATCGAGTATCTGAATTATTTCTC
GACAGACGAATCGCTGCGGCCGGGTCGGGTGGTGATCGACGACTTCGACTTCACGCGGCCCAGGGCGCAA
CTGGTCACGTCCAATCATCAGCCGCGCGAAACGAACTGGGGCGAGGGCGAGCTTTTCGAGTGGCCGGGCG
ACTATACGGACAGCAAGCACGGCGACCTGATCAGCCGGGTCCGGATGGAGGAGCGTCGCGCGCCGGGCAC
CCGCGCATTCGGCAAAGGCAACGTGCGAGGTGTCGCATGCGGCCAGACCTTCACGCTCACGAAGCACAAG
CATGACGACGCGAACCGGGAGTACATCGTCATCGAAGCCGCGTTGATGATGACCGAAATCGCCGACGAAA
CCGGCAGCGGTTACCACTACGAATGTAACAACGAGCTGATCGTTCAGCCGACGAGCGAAGTGTTCCGGAT
GCCACGAGAGACGCCGAAGCCGACCACGAGTGGCCCGCAGTCGGCGATCGTCGTCGGCCCGCCAGGCCAC
GAGGTGTGGACCGACGAGTTCGGTCGCGTGAAGGTGCGCTTCATGTGGGACCGATACGCACGCAACGACG
CGACGGATTCATGTTGGGTGCGAGTCAGCCAGGCATGGGCGGGCGTGAACTTCGGCGGCATCTATATCCC
GCGGATCGGACAGGAGGTGATAGTCGGCTTCATGAACGGCGACCCGGACCGCCCGCTGATCCTCGGCAGC
CTCTACAACACAGTGACGCCGCCGCCGTGGGACTTGCCGGGAGACGCGACGAAGAGCGGCTTCAAGAGCA
AGTCGATCAAGGGCGGCCGCGAAAACTACAACGGCATCCGTTTCGAGGACAAGCCGGGGGTTGAGGAATT
CCACATGCAGGCGGAGCGAGACATGAACCGCCTGACGAAGAGCAGCGAGTCGCATACCGTCGGCGTGAAT
TTTTCGATCGGGGTGGGCCTCGCGCACAATCGCGCGGTGGGCGGCATGTTCAGCAGCATCGTGGGTGGCG
CGGCCAGCTATGCGGTGGGCGGCGCCGAGTCGACGATCGTCGGCGGCGCTAGCGCGTTGAACGTAGGCGG
TGCGTATGCGATCGCGGTGGGCGGACCGATGTCGACCTCCGTTGGGGGCGCGTATGCGTTGACCGTCGGC
GGGGCGCTTTCCATCGTGTGCGGTGCGGCGGCCATTAACATGACGGCCGATGGCACGATCAAGCTGGTCG
GTACGAAAATCAAAGTGGTTGGCAGCGATGAGGTCGTGATCCAGGGTTCGCCGTTGCAACTGAACCCGGG
ACGCGAGGACGGTGCCGGTGGAGGCGGGGGCGGTGCGATTCCGCCGATTCCGGTGCCGTTGTTCTTCAGG
TCGATTACCGTGCCGATTTTGCCGCCGCTGCCGCCGCCGCCGGCCCTTCCGCCAGCGCCGAGCAGTGAGC
CGCCGCCGCCGAGCAGTGAGCCGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCGCCGCCGCC
GAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCGCCGCCGCCGAGCAGTGAGCCGCCGCCGCCGAGCAGT
GAGCCGCCGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCAC
CGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCGCCGCCGCCGAGCAGTGAGCCGCCGCCGCC
GAGCAGTGAGCCGCCGCCGCCGAGCAGTGAGCCGCCGCCGCCGAGCAGTGAGCCGCCGCCGCCGAGCAGT
GAGCCGCCGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCAC
CGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCGCCGCCGCCGAGCAGTGAGCCGCCGCCGCC
GAGCAGTGAGCCGCCGCCGCCGAGCAGTGAGCCGCCGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGT
GAGCCGCCGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCAC
CGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCACCGCCGCC
GAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGT
GAGCCGCCGCCGCCGAGCAGTGAGCCGCCGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCAC
CGCCGCCGAGCAGTGAGCCGCCGCCGCCGAGCAGTGAGCCGCCGCCGCCGAGCAGTGAGCCGCCGCCGCC
GAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCAGTGAGCCACCGCCGCCGAGCGAA
GAGCCGCCGCCATCGGAGTTTTAA
 Primer design