SecReT6
Protein ID: 172064686
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6683
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]184938..185204 [+]
ProductPAAR repeat-containing protein
NotePAAR
UniProt IDB1Z6L0
KEGG IDbac:BamMC406_6683
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.80E-15, Aligned region: 7..80
Protein Sequence: 88 a.a.     [Download]
>gi|172064686|ref|YP_001812336.1| PAAR repeat-containing protein [Burkholderia ambifaria MC40-6]
MSNSAARVGDAIGHGGAIVTGSGDVFTNGISAAYVGSVAVCGLHCSAQAVVVGSGSVFINGSAAAFVGRC
TSCGAPIASGSGDVFIGG
 
Nucleotide Sequence: 267 bp     [Download]
>gi|172064525|ref|NC_010553.1|:184938-185204 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGAGCAATTCCGCAGCCAGAGTCGGTGACGCGATAGGCCACGGCGGAGCAATCGTGACCGGATCTGGTG
ACGTCTTCACCAACGGGATATCGGCTGCCTATGTTGGCAGCGTTGCGGTCTGCGGCCTTCATTGTTCGGC
CCAAGCGGTCGTCGTCGGTTCGGGATCTGTCTTCATCAACGGCTCGGCCGCCGCTTTCGTAGGGCGTTGT
ACGTCGTGCGGCGCCCCGATCGCATCGGGATCGGGCGATGTGTTCATTGGCGGCTAA
 Primer design