SecReT6
Protein ID: 172064690
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6687
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]191342..192406 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB1Z6L4
KEGG IDbac:BamMC406_6687
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.40E-20, Aligned region: 61..120
Protein Sequence: 354 a.a.     [Download]
>gi|172064690|ref|YP_001812340.1| ImpA domain-containing protein [Burkholderia ambifaria MC40-6]
MNANTPGAVLRYADLLEPVSDDVPCGPDLEYDPAFVMLQAAVAPRTDAQYGDFVDAPQPANWAEAERACR
ALMLRTKDIRLLTILIRCRIRQSGAEGLRDGVILLRRMLDRYGEALHPTPVIDGERDPIVYSNAIAALAD
ADATLGDARDIPLPKTAGLQLQLRDIEKAFAVPRAKDALAPESATRLLGELWNRRDPTIIALAEAQHAVA
EISARTRDALQADAPDLDGITKLLQPFAQTSAEAGRAPATSRPLDAPSDPASAPDAGAASVPLADTEMHE
ADAPALTAPAGRPTDRWSALAAIQETRLWFEQNEPSSPVIVLLRQSERMVGKRFSELAQVIPAELLAQWD
AIDV
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|172064525|ref|NC_010553.1|:c192406-191342 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGAATGCGAATACGCCCGGCGCGGTGCTGCGCTACGCGGATCTCCTCGAACCTGTTTCGGACGATGTGC
CGTGCGGCCCCGATCTCGAATACGATCCGGCCTTCGTGATGCTGCAGGCAGCCGTCGCGCCCAGAACGGA
CGCGCAATACGGCGATTTCGTCGACGCGCCGCAACCGGCGAACTGGGCCGAAGCCGAGCGCGCCTGCCGC
GCGCTGATGCTACGCACGAAGGACATCCGGCTGCTTACGATCCTGATCCGCTGCCGCATCCGCCAAAGCG
GCGCCGAAGGTCTGCGCGACGGTGTCATTTTATTGCGGCGGATGCTCGACCGCTACGGCGAGGCATTGCA
TCCGACTCCGGTTATCGACGGCGAGCGCGATCCGATCGTCTACTCAAACGCGATTGCCGCCCTCGCCGAC
GCCGATGCGACGCTCGGGGACGCCCGCGACATCCCGCTGCCGAAAACTGCCGGCCTGCAGTTGCAGTTGC
GCGACATCGAGAAAGCGTTCGCCGTCCCGCGCGCCAAGGATGCGCTCGCGCCGGAATCGGCGACGCGACT
GCTCGGCGAACTGTGGAATCGGCGCGACCCAACGATCATCGCGCTGGCGGAGGCGCAGCATGCCGTCGCC
GAAATTTCCGCGCGAACGCGTGACGCTTTGCAGGCCGACGCACCGGACCTCGACGGCATCACGAAACTGC
TGCAGCCGTTCGCGCAGACGTCCGCCGAAGCGGGCCGCGCACCGGCCACCTCCCGTCCGCTCGACGCACC
GTCGGATCCGGCATCGGCGCCGGATGCGGGCGCGGCCTCCGTCCCGCTCGCCGACACGGAAATGCACGAG
GCCGATGCCCCGGCGCTGACAGCGCCCGCCGGGCGGCCGACGGATCGCTGGAGCGCGCTCGCGGCGATTC
AGGAGACGCGCCTTTGGTTCGAGCAAAACGAGCCGAGCAGCCCCGTCATCGTGCTGCTCCGGCAGTCCGA
ACGCATGGTTGGCAAGCGCTTTTCCGAGCTTGCGCAGGTGATTCCCGCCGAGCTTCTCGCGCAATGGGAC
GCGATTGACGTCTAA
 Primer design