SecReT6
Protein ID: 172064691
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6688
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]192403..193464 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDB1Z6L5
KEGG IDbac:BamMC406_6688
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-101, Aligned region: 27..328
Protein Sequence: 353 a.a.     [Download]
>gi|172064691|ref|YP_001812341.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MDMFNSTPIEAGSPLHPDSLRTWFDERAPWQAGFLSLLRTISARDPSMPQPGTARLPREEPFRVGQHPSM
AFAPREVAALDLRGGRLDVRLFGLGLWGPHGPLPLHMTELAYSRSESQQDQTLIAFANLFHHRALTLFYR
AWASAQATVSLDRPEHETFSFYIGSLMGTDPAEAVRIHPPAHARYAASAHLVREARNPDGLAATLSHYFG
VPVAVDEFVPHWIQVSRTERCLLGAPATSTIMGEGALLGDMIPDCQHKFRLVIGPLDLDQYLRLTPHGDD
LPTLVDWVRAFVGYEYDWEIKLLVKPHAAPPARADSTHRLGYSTWLGESMDDEPVVGMVFDPEKYCDQLE
NSA
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|172064525|ref|NC_010553.1|:c193464-192403 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGGATATGTTCAATTCCACTCCGATCGAGGCCGGCTCGCCGCTGCATCCGGATTCGCTGCGCACATGGT
TCGACGAGCGCGCGCCGTGGCAAGCGGGTTTCCTGAGCCTGCTGCGCACAATCAGCGCACGCGACCCGTC
CATGCCGCAGCCCGGCACTGCCCGCTTGCCGAGAGAGGAGCCGTTCCGCGTCGGTCAGCATCCGTCGATG
GCGTTCGCCCCGCGTGAAGTCGCGGCGCTCGACTTGCGGGGCGGCCGGCTCGACGTCCGGCTTTTCGGGC
TAGGGCTCTGGGGGCCGCACGGCCCTCTGCCGCTGCACATGACGGAACTGGCGTACAGCCGCTCGGAGAG
TCAGCAGGATCAGACACTCATCGCATTCGCCAATCTGTTTCATCATCGCGCGCTCACGCTGTTCTACCGG
GCGTGGGCGTCGGCGCAAGCGACGGTTTCGCTCGACCGGCCGGAGCACGAAACCTTCTCGTTCTATATCG
GCAGCCTGATGGGCACCGATCCCGCCGAAGCAGTGCGCATCCACCCGCCGGCGCACGCGCGCTACGCTGC
GTCGGCGCATCTGGTGCGCGAGGCGCGCAATCCCGACGGTCTCGCGGCGACACTATCCCATTACTTCGGC
GTGCCAGTGGCGGTCGACGAATTCGTGCCGCACTGGATTCAGGTTTCCCGCACGGAGCGCTGCCTGCTCG
GTGCGCCGGCGACATCGACCATCATGGGCGAGGGCGCGCTGCTCGGCGACATGATCCCCGATTGCCAGCA
CAAGTTCCGACTCGTAATCGGGCCGCTCGATCTTGACCAGTACCTGCGCCTCACGCCCCACGGCGACGAC
CTGCCCACCTTGGTCGACTGGGTCCGCGCGTTCGTCGGTTACGAATACGACTGGGAAATCAAGCTGCTGG
TCAAGCCGCACGCCGCGCCGCCGGCACGCGCCGACAGCACGCACCGGCTCGGTTACTCGACCTGGCTCGG
CGAATCCATGGACGACGAGCCCGTCGTCGGAATGGTGTTCGATCCCGAAAAATACTGCGACCAACTGGAA
AACTCAGCATGA
 Primer design