SecReT6
Protein ID: 172064692
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6689
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]193468..195348 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDB1Z6L6
KEGG IDbac:BamMC406_6689
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.10E-207, Aligned region: 5..624
Protein Sequence: 626 a.a.     [Download]
>gi|172064692|ref|YP_001812342.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MDPRFLDHYNRELTYMRELSAEFAAQHPKIARRLGMQDIEIADPYVERMIEAFCFMSARTQLKLEAEFPR
FTQRLLEVVYPNYVAPTPSMAVARLHPSLREGDFSKGFKVARYSVLRSSVPPGEQTACEFRSGHEVTLWP
IEIVDAKLTAVPPDLPDMERSLMPHVQLRGALRLRLRTVGEIKFSQISALDRVSLYIGGDERIASHLFEL
IHASSVASVVRAYGAARTDCAVVAKNPVDFEGLSPEQSLLPQIWNTFHGHNLLHEYFTCRQRFYFFVLTQ
LQAGLSAIDGQEAEIVLLLDRLPDELVTHVDASSFQLFCTPIINLFPRRTDRIEINRQSTAFHLIPDRSR
PLDYEVFSVSRVFGQKAESSAEVAFNPLYQTLHSDIGNYGRYFSVLREPRTMSVNARKYGTRSQYIGTEV
FVSLVDQAEAPYADTIRYLSVDAWLTNRDLPRLIPRNGVNDLTMQDSVPIEGVSLVHPPSAPREPYATGQ
TAWRLIRQLSFNYMPLAELDHRDGGQALRNMLRLFVGTSEHEQLTQIESLVGTRTEPVVRRLPEHGLLVY
GRGVRCELTIDETGFSGMSPYLFGLVLEQYLSRHVSINVFTETELRSMQRGLVTRWKPRMGARGAV
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|172064525|ref|NC_010553.1|:c195348-193468 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGGACCCCAGATTTCTCGATCACTACAACCGCGAACTGACCTACATGCGGGAGTTGTCCGCGGAGTTCG
CCGCGCAGCACCCGAAGATCGCCCGCCGGCTCGGCATGCAAGATATCGAGATCGCCGATCCGTACGTGGA
GCGGATGATCGAGGCATTCTGCTTCATGTCGGCCCGTACCCAGTTGAAGCTGGAGGCCGAATTCCCGCGC
TTCACGCAGCGACTGCTCGAGGTCGTGTATCCGAACTACGTCGCGCCGACGCCCTCGATGGCTGTGGCGC
GGCTGCACCCGAGCCTGCGCGAAGGCGATTTCAGCAAGGGTTTCAAGGTAGCGCGTTACAGCGTGCTGCG
TTCGTCGGTGCCCCCGGGCGAGCAGACGGCCTGCGAGTTCCGCAGCGGCCACGAAGTCACACTGTGGCCG
ATCGAGATCGTCGACGCGAAGCTGACCGCCGTGCCGCCGGATCTTCCCGACATGGAGCGCAGCCTGATGC
CGCACGTACAGCTGCGCGGCGCGCTGCGGCTGCGGCTGCGCACGGTCGGCGAGATAAAGTTCTCGCAGAT
CTCGGCACTCGACCGCGTGTCGCTCTACATCGGCGGCGATGAGCGGATCGCGTCGCATCTGTTCGAACTG
ATCCATGCAAGCAGCGTCGCATCGGTTGTGCGCGCATACGGCGCCGCCCGCACCGATTGCGCGGTCGTCG
CGAAAAACCCGGTCGACTTCGAAGGCCTCAGTCCCGAGCAGAGCCTGCTGCCGCAGATATGGAATACGTT
CCACGGACACAACCTGCTACACGAATACTTCACCTGCCGGCAGCGCTTCTATTTCTTCGTGCTGACACAG
TTGCAGGCCGGCCTGTCCGCGATCGACGGCCAAGAAGCGGAAATCGTGCTGCTGCTGGACCGCCTGCCGG
ACGAACTGGTGACGCACGTCGATGCGTCGAGCTTCCAGTTGTTCTGCACGCCGATCATCAACCTGTTTCC
CCGGCGCACCGATCGCATCGAGATCAACCGGCAGTCGACAGCGTTCCACTTGATACCGGATCGCAGCCGC
CCGCTCGATTACGAGGTGTTCTCGGTGTCGCGCGTGTTCGGCCAGAAAGCCGAGTCGTCGGCCGAAGTGG
CGTTTAATCCGCTGTATCAGACGTTACACAGTGATATCGGCAATTACGGCCGCTATTTCTCGGTCCTGCG
CGAGCCCCGCACGATGTCTGTCAATGCGCGCAAGTACGGCACGCGCAGCCAGTACATCGGCACCGAGGTA
TTCGTTTCGCTCGTCGACCAGGCCGAAGCGCCGTATGCCGACACGATCCGCTATCTGTCCGTGGACGCGT
GGCTGACCAACCGGGACCTGCCGCGCCTGATTCCTCGAAACGGCGTCAACGACCTCACGATGCAGGACTC
GGTGCCGATCGAGGGCGTGAGCCTCGTGCATCCGCCGAGCGCGCCGCGCGAACCGTACGCGACGGGCCAG
ACCGCCTGGCGGCTGATTCGCCAACTGAGCTTCAATTACATGCCGCTCGCGGAACTCGATCATCGAGACG
GCGGCCAGGCGCTGCGCAACATGCTGCGGCTCTTCGTTGGCACGAGCGAGCACGAACAGCTCACGCAGAT
CGAGAGCCTCGTCGGCACGCGCACTGAACCCGTCGTGCGGCGCCTGCCCGAACACGGCCTGCTCGTATAT
GGGCGCGGCGTGCGCTGCGAACTGACGATCGACGAGACCGGCTTCTCGGGCATGAGCCCCTACCTGTTCG
GTCTCGTGCTCGAGCAGTACCTGTCGCGGCACGTGTCGATCAACGTCTTTACTGAGACGGAACTTCGCTC
GATGCAACGCGGCCTCGTGACGCGCTGGAAGCCCCGTATGGGTGCACGGGGGGCGGTGTAG
 Primer design