SecReT6
Protein ID: 172064693
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6690
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]195350..195871 [-]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDB1Z6L7
KEGG IDbac:BamMC406_6690
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.50E-18, Aligned region: 41..148
Protein Sequence: 173 a.a.     [Download]
>gi|172064693|ref|YP_001812343.1| type VI secretion system lysozyme-related protein [Burkholderia ambifaria MC40-6]
MTRPPDNLHRPAYLPSLLDRLQDDAPHARHEKPSAYAPNGDGMRRIIQRDLALLLNATNLDGELDAVRYP
HAAASVVNYGVPPLSGSYLSDRNWETIEKLIRTAIVRFEPRLLRDSIAIRPIVGQEAASYNKLMFEIRGL
MQWSPYPLEFLIQSTFDIETNKVTFDPGARTGN
 
Nucleotide Sequence: 522 bp     [Download]
>gi|172064525|ref|NC_010553.1|:c195871-195350 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGACGCGGCCCCCTGACAACCTGCACCGGCCAGCCTACCTGCCGTCTCTGCTCGACCGGTTGCAGGACG
ACGCGCCACACGCGCGCCACGAGAAGCCCAGCGCCTACGCCCCTAACGGCGATGGCATGCGCCGCATCAT
TCAGCGCGACCTCGCCTTGCTGCTCAACGCAACCAATCTCGACGGCGAGCTGGACGCCGTCCGCTACCCG
CACGCCGCCGCGTCCGTCGTCAACTACGGCGTGCCGCCGTTGTCGGGGAGCTATCTGAGCGACCGGAACT
GGGAAACGATCGAAAAGCTCATCCGCACCGCGATCGTCCGTTTCGAGCCGCGACTGCTGCGGGACTCGAT
CGCGATCCGGCCCATCGTCGGACAGGAGGCCGCCAGCTACAACAAGCTAATGTTCGAGATTCGCGGACTG
ATGCAATGGTCGCCGTACCCGCTCGAATTTCTCATCCAGAGCACCTTCGACATCGAAACCAACAAGGTAA
CGTTCGATCCGGGCGCTCGCACCGGAAATTGA
 Primer design