SecReT6
Protein ID: 172064694
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6691
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]195855..196715 [-]
Productvirulence protein SciE type
NoteTagJ
UniProt IDB1Z6L8
KEGG IDbac:BamMC406_6691
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 8.90E-48, Aligned region: 156..276
Protein Sequence: 286 a.a.     [Download]
>gi|172064694|ref|YP_001812344.1| virulence protein SciE type [Burkholderia ambifaria MC40-6]
MTANTPDPAAQATPQPKPQNLLRTQSLDTLKEQTVETVRRRPADASERWLLFQLLCLDGDWERALKQLQT
WATLEPEGEARAQLHRGLIQSEMFRTGVFAGIRTPGFIDETVPAWVDQLLQANARLGAGDVAGADALRRA
ALDDAPASRGASPEMGDFDWLSDSDTRLGPVCEMAVAGGYRWIPFARIKSLTLTPIGTLTDFVWRPATIV
LRDATVLRGYVPTRYPGSEHGPAAIQLARETRWQDVGETNVIALGQKTWSTDRGDWGLLDIGGCRFTNES
DDDAAP
 
Nucleotide Sequence: 861 bp     [Download]
>gi|172064525|ref|NC_010553.1|:c196715-195855 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGACCGCGAATACCCCTGATCCGGCCGCGCAGGCCACCCCCCAGCCGAAGCCGCAAAACCTGCTGCGCA
CCCAGTCGCTCGATACGCTGAAGGAGCAGACCGTCGAAACGGTCCGCCGGCGTCCGGCCGACGCGTCGGA
ACGCTGGCTGCTGTTTCAGTTGCTGTGCCTCGACGGCGACTGGGAGCGCGCGCTCAAGCAGTTGCAGACC
TGGGCAACGCTCGAGCCCGAGGGCGAGGCGCGCGCGCAACTGCATCGCGGTCTGATCCAGAGCGAGATGT
TCCGCACCGGAGTATTCGCCGGCATCCGTACGCCCGGCTTCATCGATGAAACCGTGCCCGCGTGGGTTGA
CCAGTTGCTGCAGGCGAACGCGCGGCTCGGCGCCGGAGACGTAGCCGGCGCCGACGCGCTGCGCCGGGCC
GCGCTCGACGACGCGCCGGCGAGCCGCGGAGCAAGCCCCGAGATGGGTGACTTCGACTGGCTGAGCGACA
GCGACACGCGGCTCGGACCGGTCTGCGAAATGGCCGTGGCCGGCGGTTACCGCTGGATTCCATTCGCCCG
GATCAAGTCGCTGACACTAACGCCAATCGGCACGCTGACCGACTTCGTTTGGCGGCCGGCCACAATCGTC
CTGCGCGACGCCACGGTGCTCCGGGGCTACGTGCCGACGCGCTACCCCGGCTCGGAACACGGTCCCGCCG
CGATCCAACTCGCACGCGAAACCCGCTGGCAGGATGTCGGCGAAACCAACGTGATCGCGCTCGGCCAAAA
AACCTGGTCGACCGACCGGGGCGACTGGGGCCTGTTGGATATCGGCGGCTGCCGCTTCACGAACGAAAGC
GACGATGACGCGGCCCCCTGA
 Primer design