SecReT6
Protein ID: 172064696
SecReT6 ID271
T6SS typei3
Gene symbol-
Locus tagBamMC406_6693
StrainBurkholderia ambifaria MC40-6
Repliconplasmid pBMC401 [GenBank: NC_010553] [Browse all T6SS(s) in this replicon]
Location [Strand]198229..200898 [+]
Producttype VI secretion ATPase
NoteTssH
UniProt IDB1Z6M0
KEGG IDbac:BamMC406_6693
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.90E-38, Aligned region: 231..310
AAA_2 [PF07724], Evalue: 2.90E-38, Aligned region: 389..399
AAA_2 [PF07724], Evalue: 2.90E-38, Aligned region: 610..776
AAA [PF00004], Evalue: 9.80E-21, Aligned region: 233..364
AAA [PF00004], Evalue: 9.80E-21, Aligned region: 615..699
ClpB_D2-small [PF10431], Evalue: 6.20E-14, Aligned region: 782..853
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 233..255
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 614..718
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 34..72
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 210..252
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 274..311
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 378..399
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 484..511
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 610..657
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 679..697
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 775..796
Sigma54_activat [PF00158], Evalue: 2.30E-07, Aligned region: 229..313
Sigma54_activat [PF00158], Evalue: 2.30E-07, Aligned region: 613..713
AAA_19 [PF13245], Evalue: 4.50E-07, Aligned region: 231..255
AAA_19 [PF13245], Evalue: 4.50E-07, Aligned region: 612..636
AAA_22 [PF13401], Evalue: 7.40E-07, Aligned region: 233..314
AAA_22 [PF13401], Evalue: 7.40E-07, Aligned region: 366..401
AAA_22 [PF13401], Evalue: 7.40E-07, Aligned region: 613..637
AAA_22 [PF13401], Evalue: 7.40E-07, Aligned region: 676..700
AAA_29 [PF13555], Evalue: 3.00E-05, Aligned region: 225..251
AAA_29 [PF13555], Evalue: 3.00E-05, Aligned region: 612..639
AAA_29 [PF13555], Evalue: 3.00E-05, Aligned region: 752..764
AAA_17 [PF13207], Evalue: 3.70E-05, Aligned region: 234..272
AAA_17 [PF13207], Evalue: 3.70E-05, Aligned region: 453..497
AAA_17 [PF13207], Evalue: 3.70E-05, Aligned region: 614..652
IstB_IS21 [PF01695], Evalue: 4.30E-05, Aligned region: 225..257
IstB_IS21 [PF01695], Evalue: 4.30E-05, Aligned region: 614..634
AAA_18 [PF13238], Evalue: 4.40E-05, Aligned region: 233..272
AAA_18 [PF13238], Evalue: 4.40E-05, Aligned region: 615..646
Zeta_toxin [PF06414], Evalue: 8.10E-05, Aligned region: 233..252
Zeta_toxin [PF06414], Evalue: 8.10E-05, Aligned region: 607..654
AAA_14 [PF13173], Evalue: 0.00013, Aligned region: 233..314
AAA_14 [PF13173], Evalue: 0.00013, Aligned region: 613..696
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 27..74
NACHT [PF05729], Evalue: 0.0012, Aligned region: 233..261
NACHT [PF05729], Evalue: 0.0012, Aligned region: 614..641
AAA_25 [PF13481], Evalue: 0.0016, Aligned region: 233..270
AAA_25 [PF13481], Evalue: 0.0016, Aligned region: 482..527
AAA_25 [PF13481], Evalue: 0.0016, Aligned region: 612..640
AAA_30 [PF13604], Evalue: 0.0029, Aligned region: 223..254
AAA_30 [PF13604], Evalue: 0.0029, Aligned region: 613..644
UPF0079 [PF02367], Evalue: 0.0051, Aligned region: 233..253
UPF0079 [PF02367], Evalue: 0.0051, Aligned region: 612..640
TIP49 [PF06068], Evalue: 0.0052, Aligned region: 233..254
TIP49 [PF06068], Evalue: 0.0052, Aligned region: 284..313
TIP49 [PF06068], Evalue: 0.0052, Aligned region: 613..649
Protein Sequence: 889 a.a.     [Download]
>gi|172064696|ref|YP_001812346.1| type VI secretion ATPase [Burkholderia ambifaria MC40-6]
MTISRQALFGKLSHSLFRSVESATTFCKLRGNPYVELVHWLHQLLQAPDGDLQRIVRHCDIDAETLDRDV
LRALAALPAGASSISDFSHHVETTIERAWVLASLNFGDRRIRGAWLVAALVKTPELRRVLLSISPAFGKI
PLDSLAEMLPAWIDGSPEAGDAPYDGTDFGGAVPGEVAGALAPSMAGGSPLEQYCSDLTARARAGEIDPV
VGRELEIRTMIDVLLRRRQNNPLLTGDAGVGKTAVVEGLARAVVDGDVPPKLADVRLLSLDVGALLAGAS
MKGEFEARLKGVLEAATKSTVPVILFVDEIHTLIGAGGHAGTGDAANLLKPALARGTLRTIGATTWSEYK
RYIEKDPALTRRFQVLQVPEPEEAAAIDMVRGLARTFSRHHGVVLLDEAIRAAVTLSHRYIPSRQLPDKA
ISLLDTACARVALSQHAPPGELQDVRQRLQAARVECDLIDHEWRIGLGDGDALARSRARIADLEREADGV
EARWRAQADAAQALLSAREAAAEAQGDVPDAGLHAFERALADLQGETALVFPEVNEVIVAEIVSDWTGIP
VRRMVTDEVTAVLALPDTLSARVIGQSDALLQIGERVQTARAGLTDPKKPLGVFLLAGPSGVGKTETALA
LAEALYGGEQNLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHGDVH
EMFFQVFDKGYMEDGDGRYIDFRHTTILLTSNAGSDLIASLCADEMLVPDADALRTALVPELLKTFPAAF
LGRVTVVPYRPLAQATLSQIVRLHLDRVVARMADGHGVAFSYAPAVLDYIVDRCLVQETGARLLIGFLEQ
HVLPRLAAQWLDALESKRTLTRVELDLADAGAAPAEAFVFHASGAQADE
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|172064525|ref|NC_010553.1|:198229-200898 Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence
ATGACGATTTCAAGGCAAGCCCTGTTCGGCAAACTCAGCCATTCGCTATTCCGCAGCGTCGAATCCGCGA
CGACTTTTTGCAAGTTGCGCGGCAACCCTTACGTCGAGCTGGTGCATTGGTTGCATCAACTACTGCAGGC
TCCCGACGGCGATTTGCAGCGAATCGTTCGGCACTGCGACATCGACGCCGAGACGCTCGACCGAGACGTG
CTGCGCGCGCTGGCCGCACTGCCAGCCGGCGCGAGTTCAATCAGCGATTTTTCGCACCATGTCGAGACCA
CCATCGAGCGCGCATGGGTGCTGGCTTCGCTGAATTTCGGCGATCGGCGGATTCGTGGCGCGTGGCTCGT
CGCCGCGCTCGTCAAAACGCCCGAGTTGCGTCGCGTGCTGTTGTCGATCTCCCCCGCGTTCGGCAAGATT
CCGCTTGATAGCCTGGCCGAGATGTTGCCTGCTTGGATCGACGGATCGCCGGAGGCCGGAGACGCGCCGT
ACGATGGCACCGATTTCGGTGGCGCCGTGCCGGGCGAGGTGGCCGGCGCGCTCGCGCCGTCGATGGCCGG
CGGCTCGCCGCTCGAGCAGTACTGCAGCGATCTCACGGCCCGGGCGCGCGCGGGCGAGATCGACCCGGTT
GTGGGGCGCGAACTCGAGATCCGCACGATGATCGACGTGCTGTTGCGCCGGCGTCAAAACAATCCGCTGC
TCACGGGCGATGCGGGCGTCGGCAAGACGGCTGTGGTCGAGGGCCTCGCCCGAGCGGTCGTCGACGGCGA
CGTGCCGCCGAAGCTCGCCGACGTGCGCCTGCTGAGTCTTGACGTCGGCGCGCTGCTCGCCGGCGCAAGC
ATGAAGGGCGAGTTCGAGGCGCGCCTCAAGGGCGTGCTTGAGGCGGCGACGAAATCGACCGTGCCGGTCA
TTCTGTTCGTCGACGAGATCCACACGCTGATTGGTGCGGGCGGCCACGCCGGCACGGGCGACGCCGCGAA
CCTGCTGAAGCCGGCGCTGGCGCGCGGCACGCTGCGGACGATCGGCGCGACGACTTGGTCCGAATACAAG
CGGTATATCGAAAAGGACCCGGCGCTGACGCGCCGCTTCCAGGTGCTCCAGGTCCCGGAGCCTGAGGAGG
CAGCCGCGATCGACATGGTGCGCGGGCTCGCGCGGACCTTCTCTCGGCATCACGGGGTCGTCTTGCTTGA
CGAGGCAATTCGCGCGGCGGTCACGCTGTCGCATCGCTACATTCCGTCCCGGCAACTGCCGGATAAGGCG
ATCAGCCTGCTCGATACTGCCTGCGCACGCGTGGCGCTGTCTCAGCACGCGCCGCCGGGCGAGCTGCAGG
ACGTGCGCCAGCGATTACAGGCCGCGCGCGTCGAATGCGACCTGATCGACCATGAATGGCGCATCGGTCT
CGGCGACGGGGACGCGCTGGCCCGCTCGCGGGCGCGCATTGCGGATCTGGAACGGGAGGCGGACGGCGTC
GAGGCGCGCTGGCGGGCGCAGGCCGATGCCGCGCAGGCATTGTTGAGCGCGCGGGAGGCGGCCGCCGAAG
CCCAGGGCGACGTGCCGGACGCTGGATTGCATGCGTTTGAGCGCGCGCTCGCGGATCTGCAGGGCGAGAC
GGCGCTCGTCTTCCCAGAAGTGAATGAGGTGATCGTCGCCGAAATCGTGTCGGACTGGACCGGCATTCCG
GTGCGCAGGATGGTTACCGACGAGGTCACGGCGGTGCTCGCGCTCCCCGACACTCTGTCGGCCCGTGTGA
TCGGGCAGTCGGATGCGTTGCTGCAGATCGGCGAGCGGGTGCAGACCGCGCGCGCAGGGCTGACCGACCC
GAAAAAGCCGCTGGGCGTCTTCCTGCTTGCCGGCCCGTCGGGCGTGGGCAAGACAGAGACGGCGCTGGCG
CTTGCCGAGGCGCTGTACGGCGGTGAGCAGAACCTGATCACGATCAACATGAGCGAGTATCAGGAGGCCC
ATACGGTTTCCGGGTTGAAGGGCGCGCCGCCTGGCTATGTCGGTTACGGCGAGGGAGGCGTACTGACCGA
GGCAGTGCGGCGCCGGCCGTATTCGGTCGTCCTGCTCGACGAGATCGAGAAGGCGCATGGCGATGTCCAT
GAGATGTTCTTTCAGGTGTTCGATAAGGGTTATATGGAAGACGGCGACGGCCGCTACATCGATTTCCGCC
ACACAACGATCCTGCTCACGAGCAATGCTGGCTCCGATCTGATCGCGAGCCTGTGTGCGGACGAAATGCT
CGTGCCCGACGCGGACGCGCTGCGCACGGCGCTCGTACCGGAATTGCTGAAGACGTTCCCTGCGGCATTT
CTCGGTCGCGTGACGGTGGTGCCGTACCGGCCGCTCGCGCAGGCGACGCTTTCGCAAATCGTGCGCCTGC
ATCTGGACCGCGTCGTCGCCCGCATGGCCGACGGACACGGCGTGGCGTTCAGCTACGCGCCGGCCGTGCT
CGATTACATCGTTGACCGTTGTCTAGTGCAGGAAACGGGGGCGCGCTTACTGATCGGGTTTCTCGAGCAG
CACGTGCTACCGCGACTCGCCGCGCAATGGCTCGACGCGCTGGAGTCGAAGCGCACGCTCACTCGCGTTG
AGCTCGATTTGGCCGACGCGGGCGCAGCGCCAGCGGAGGCATTCGTGTTCCATGCGTCCGGCGCGCAAGC
GGATGAATGA
 Primer design