SecReT6
Protein ID: 172087682
SecReT6 ID84
T6SS typei1
Gene symbolicmF
Locus tagVF_0993
StrainVibrio fischeri ES114
Repliconchromosome I [GenBank: NC_006840] [Browse all T6SS(s) in this replicon]
Location [Strand]1092603..1096124 [-]
Productsecretion protein IcmF
NoteTssM
UniProt IDQ5E658
KEGG IDvfi:VF_0993
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.40E-73, Aligned region: 200..455
ImcF-related_N [PF14331], Evalue: 1.40E-73, Aligned region: 586..625
IcmF-related [PF06761], Evalue: 1.50E-67, Aligned region: 501..795
DUF1215 [PF06744], Evalue: 1.40E-29, Aligned region: 908..1025
MMR_HSR1 [PF01926], Evalue: 0.0021, Aligned region: 135..245
Protein Sequence: 1173 a.a.     [Download]
>gi|172087682|ref|YP_204376.2| secretion protein IcmF [Vibrio fischeri ES114]
MKSFFNSLLNTLKKTWCWSLLLTLFIALLLCLFGKHIAIANTPLIETTTGKTLTIIICLLLWGAFNLTLW
GLAKREAQKEENKEAYEAAQSEMAFIREHSTILKTKLEAAIATIKRAGLYGKLNNNVKYQLPWYMVIGPQ
NSGKTTLLECSGLDFPLNQTDGHYTRDIQNSQHCEWYFANHAVLLDAAGRFFDQHENELSKPIWGNFLKA
LRNKRRRRPLNGVILTIDITTLQSPDESAIEVQARYVRERLQELRHDLSSDMPIYFLLTKMDKVEGFEPF
FSSLSREEMDQVFGVTFNEGEGQQADKIKHEFEKLILRIDSQVMSRLHDERDVMKRAELLQFPRQLSFLA
ERLALFSELAFTKTRYHQASHLRGLYLTSVPEPTNTQTESTTSGIGQNLGISSRVLPTYKHQRGFFIRKL
LEDVIFPNSELATLDEKYEKQVKLKNMAVYAASFALVIGFGSLWATSFLTNHHKQQELLSLSGDYNQQIV
HLSPLAPSIELLPTLNTLLAATQVYSKESETLTDEFAGLQQGDKLRKAAEAAYHRSLLSLLLPKVTSELE
YQVANNQDNREFLTPSLRAYLMLNLHEHLDKAYLEQWMGLHWSYLYSGSATEQKELQAHFSNLLNIEFEP
VQLNDNLIAKSRKFLREADTSELVYQQLKQDAKEMDLRDIKISDHLGPNQNLFNHTNTIIPGLYTQKGYK
AVFLSKGLDQVKQLIEENWVIGLSSDLSANEIRGLYADVEDLYFHDYIKYWKEAVDQLQIKPSKNMDEAI
LQISNITGSSQPILKLLNLVKENTTFVDKAQVASKTAGQVKKLPVNTKLKKVASLGLHSVEERSQSARKA
VSNQFESLNLLLTDKDQATIPLEDALVVINELSGRLSMVKFSPNPDSSAFKIARDRMQGIPNELNDIRVM
AETLPQPLQQWWKQISNNAWGIILNHSRKHVQIVYHDKVVTHYDVALSGRYPFRNSSHDVNIADFDEFFQ
NGGILDNFFDAYLSSFVYKQKGKFKQKSLHGRSLGLSDSFLDQYNYGLTIQRMFYGSKGKEANVSFRIAP
FELDASALQSTFYYGKNKFAYRHGPIQKKQFTWPITNQRQYVSFVLQDLSGSKVVNQQNSGPWAFFRVLD
KFRVNKYRGQDVIKVDLENKGMKAKYLIYSDRTPNPFNRKILTNFYLPKRING
 
Nucleotide Sequence: 3522 bp     [Download]
>gi|172087630|ref|NC_006840.2|:c1096124-1092603 Vibrio fischeri ES114 chromosome I, complete sequence
ATGAAATCATTTTTTAATTCATTGCTTAACACATTAAAAAAGACATGGTGTTGGAGCTTATTATTAACAC
TATTTATTGCCTTATTATTGTGTTTATTTGGTAAGCATATTGCGATAGCAAATACCCCATTAATTGAAAC
GACTACCGGGAAAACATTAACAATTATCATTTGCTTACTACTATGGGGAGCATTCAATCTGACTTTGTGG
GGCTTAGCAAAGCGAGAAGCACAAAAAGAAGAAAATAAAGAAGCGTATGAAGCTGCGCAATCTGAAATGG
CTTTTATTCGTGAACACAGCACCATTCTAAAAACAAAACTTGAAGCTGCAATTGCAACAATCAAGCGTGC
TGGGCTATATGGAAAACTCAATAATAACGTTAAATATCAACTTCCTTGGTATATGGTTATTGGCCCACAA
AATAGTGGTAAAACAACCCTTTTAGAGTGTTCAGGATTAGATTTCCCTTTAAACCAAACTGATGGGCATT
ACACAAGAGACATTCAAAATAGCCAACATTGTGAATGGTATTTTGCTAACCATGCCGTTCTTTTAGATGC
TGCAGGACGCTTTTTTGATCAACATGAAAATGAGTTAAGTAAACCAATTTGGGGCAATTTTTTAAAAGCT
CTACGCAATAAGCGTCGCCGTCGCCCATTAAATGGGGTCATACTAACTATTGATATCACAACATTACAAT
CTCCAGATGAAAGCGCAATCGAAGTTCAAGCTCGCTATGTACGTGAACGCTTACAAGAGTTAAGACATGA
TTTAAGCTCAGATATGCCTATCTATTTCTTATTAACGAAAATGGATAAAGTCGAGGGATTCGAACCCTTC
TTCTCTTCCCTATCCAGAGAAGAAATGGACCAAGTTTTTGGCGTCACTTTTAACGAAGGTGAAGGCCAGC
AAGCCGATAAAATTAAACATGAGTTCGAAAAGCTCATTTTACGTATCGATTCACAAGTCATGTCACGCTT
ACACGATGAGCGTGATGTGATGAAACGTGCAGAACTATTACAATTCCCACGCCAATTAAGCTTCCTTGCT
GAACGCTTAGCGTTATTTTCTGAATTAGCCTTTACTAAAACCCGTTATCACCAAGCCTCTCATTTACGTG
GTTTATACCTAACGTCAGTACCCGAACCAACAAATACCCAGACTGAATCAACCACGTCAGGTATTGGGCA
AAACCTTGGTATCAGCTCTCGAGTTCTTCCTACTTATAAACATCAACGTGGGTTCTTTATTCGAAAATTA
CTTGAAGACGTGATTTTTCCAAACAGTGAACTCGCTACATTAGATGAAAAATATGAGAAACAAGTAAAAC
TGAAAAACATGGCGGTCTATGCAGCCTCTTTTGCTCTTGTGATTGGGTTTGGTTCATTATGGGCAACCAG
CTTTTTAACCAATCATCATAAACAACAAGAGTTATTGTCTCTTTCTGGCGATTATAATCAACAGATTGTC
CATTTATCCCCTTTAGCTCCTTCTATTGAATTACTGCCAACATTAAATACTTTATTAGCAGCAACTCAAG
TGTATTCAAAAGAGAGTGAAACCCTCACAGATGAGTTTGCGGGACTCCAACAAGGAGATAAATTACGAAA
GGCAGCAGAAGCCGCATACCACAGAAGTTTACTCAGTTTACTGCTTCCTAAAGTAACAAGTGAACTCGAA
TACCAAGTGGCAAATAATCAAGATAATAGAGAATTCTTAACGCCTTCTTTACGAGCATATTTGATGCTAA
ATCTACATGAGCACCTTGATAAAGCTTATCTAGAACAATGGATGGGATTGCATTGGTCGTATTTATACAG
TGGTTCAGCAACAGAGCAGAAAGAGCTTCAAGCGCATTTTTCTAATCTATTAAATATCGAATTTGAACCA
GTTCAATTAAACGATAATTTAATCGCTAAATCTCGTAAATTTTTACGTGAAGCAGATACATCAGAATTGG
TATACCAACAGCTAAAACAAGACGCAAAAGAGATGGATCTGCGCGATATAAAAATCAGTGACCATTTAGG
ACCAAACCAAAACTTATTCAACCACACCAATACCATTATTCCTGGTTTATATACGCAAAAAGGATATAAA
GCTGTCTTTTTAAGCAAAGGATTAGACCAAGTAAAACAACTGATTGAAGAAAACTGGGTCATTGGGTTAT
CAAGTGATTTAAGTGCTAATGAGATCCGTGGACTATACGCAGATGTCGAAGACCTCTATTTCCATGATTA
CATTAAATATTGGAAAGAAGCGGTAGATCAACTTCAAATTAAACCATCTAAAAACATGGATGAAGCCATT
CTTCAAATTTCAAATATTACCGGTTCAAGCCAACCAATTTTAAAGCTTTTAAACCTAGTAAAAGAAAACA
CCACCTTTGTTGATAAGGCTCAAGTGGCTTCAAAAACTGCAGGTCAGGTTAAGAAACTACCTGTAAATAC
GAAACTGAAGAAAGTCGCCTCTCTGGGCTTACACAGTGTCGAAGAACGCTCTCAAAGCGCTCGTAAAGCG
GTAAGCAATCAATTTGAATCACTGAACCTATTACTCACAGATAAAGATCAAGCAACGATTCCATTAGAAG
ATGCGCTGGTTGTGATCAACGAACTGAGTGGACGATTATCTATGGTGAAGTTCTCACCTAACCCTGATTC
ATCAGCCTTTAAGATTGCTCGCGATCGCATGCAAGGAATACCAAATGAGTTAAATGATATACGTGTAATG
GCAGAAACGCTTCCCCAACCATTACAGCAATGGTGGAAACAAATATCAAATAACGCTTGGGGTATTATAC
TGAACCATTCAAGAAAACATGTACAAATAGTTTACCATGATAAAGTCGTTACTCATTACGATGTCGCTTT
ATCAGGTCGATACCCATTTAGAAACAGTAGCCATGATGTAAACATTGCTGACTTTGATGAATTCTTCCAG
AACGGCGGTATTTTAGACAATTTCTTTGACGCCTATTTATCCTCATTTGTTTATAAACAAAAAGGGAAAT
TCAAACAAAAGTCCTTACACGGACGTTCATTAGGGCTATCTGATTCATTCTTAGACCAATATAACTATGG
GTTGACTATCCAACGTATGTTTTATGGTTCAAAAGGAAAAGAAGCCAACGTCTCGTTCCGTATTGCGCCA
TTTGAACTTGATGCAAGCGCTTTGCAATCCACTTTCTATTACGGAAAAAACAAATTTGCTTACCGTCATG
GTCCAATACAGAAAAAACAATTTACGTGGCCAATAACCAATCAGCGTCAATACGTCAGTTTTGTTTTACA
AGATCTGAGTGGTTCTAAAGTCGTAAACCAACAAAACTCAGGTCCTTGGGCTTTCTTCCGAGTATTAGAC
AAATTCAGAGTCAATAAATACCGAGGTCAAGATGTCATAAAAGTAGATCTGGAAAATAAAGGAATGAAAG
CCAAATACCTTATTTATAGTGATCGAACCCCTAATCCTTTTAATAGAAAAATATTAACGAATTTCTATCT
TCCAAAAAGGATTAATGGATGA
 Primer design