SecReT6
Protein ID: 17548959
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0738
Locus tagRS01970
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]926494..929190 [-]
ProductVGR-related protein
NoteTssI
UniProt IDQ8XRU3
KEGG IDrso:RS01970
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.20E-64, Aligned region: 46..356
Phage_GPD [PF05954], Evalue: 4.20E-64, Aligned region: 660..763
DUF2345 [PF10106], Evalue: 3.20E-44, Aligned region: 667..818
T6SS_Vgr [PF13296], Evalue: 3.10E-35, Aligned region: 520..628
Phage_base_V [PF04717], Evalue: 5.80E-18, Aligned region: 416..502
Protein Sequence: 898 a.a.     [Download]
>gi|17548959|ref|NP_522299.1| RSp0738 gene product [Ralstonia solanacearum GMI1000]
MKSPFPLPAAVPQAVLGALLGQQTRQITLETALTSDNLVVERFTAREAVSASCVLQVDCLSPLANLDTAQ
LASQEATLRLMLADGSRRAWHGYVTDCAALGGNGGLARYRLRIGPWLDRLHTRRDCFVYQDKTALEIIED
LFADYPVAHYKLAVSQPCAKRSICCQYRETDYDFVMRLLAEEGLSLRIEHEQGDARRDGSAQSRHCVVIF
DNDAERPACAQPDIRFHRVDATEREDAIERFSQMRTVGTNAVTVSSWNYKALAATAAQASASDPGGELPA
LEAFEAAGPYRFADAQGAGRAARLRMQAHEGAYLRYLGQGSVRQLGPGQRFTLTQHFDTRHSQFVTLSVE
HEAANNLGADLARLLGTTDIESGRYRNRFVAVPAEAPIVPPYRHRPTAPEGQAATVIADDGAPLTTDRDH
RVRIRFPWLRAPALNAFAEPAGSDRSQVTAWVRVATASAGPNWGAHHLPRAGTQVLLTFVDGDIDRPLVT
MQLHNEQDALPWPAADAPLGQALSGWHSPSLGGDGYNQWVVDDHPAQLRMRLASSTAGSQLNLGYVVSHG
PTGGERGDWRGTGAELRTDAWAVVRAGGGLLLSTTARAQAGGTLLDMHEARGQLTAAQRTAQRLSDAAAS
QQALPLSANAAFDPLTQALDPAQDGHYPSSVNGQDATQPNRAPVDKFAQPLLVTESPASIALASQATTTV
YAGRHLHGTAQGDWHLAAGNVVAAAAARGVSLFAQRNGLRAIAEGGPVSIQAHTDALAVLADQAVTVISS
TESIEILAQRNIVLRGGDSVIRMEGNAITFETIKLSVKGAGHPLIGPGGRPFRIEGLPDSRVKLFEQQMR
AINERTGDPIANLPYKIVTEGGDVHYGTTDIEGKTIRVPTIKSEKVTVFWGELPPYKS
 
Nucleotide Sequence: 2697 bp     [Download]
>gi|17548221|ref|NC_003296.1|:c929190-926494 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGAAGTCACCGTTCCCCCTGCCGGCCGCCGTGCCGCAAGCCGTCCTGGGCGCGCTGCTCGGGCAGCAGA
CCCGCCAGATCACGCTGGAGACGGCGCTGACCTCCGACAACCTGGTGGTGGAACGCTTCACGGCGCGCGA
GGCGGTGTCGGCATCGTGCGTGCTGCAGGTCGATTGCCTGAGCCCCCTGGCTAACCTGGATACCGCCCAG
TTGGCTTCGCAGGAGGCCACGCTGCGCCTGATGCTCGCCGACGGCAGCCGCCGCGCCTGGCACGGCTACG
TGACCGACTGCGCGGCCCTCGGCGGCAACGGCGGGCTGGCGCGCTACCGCCTGCGCATCGGGCCCTGGCT
CGACCGCCTGCACACCCGCCGCGACTGCTTCGTCTACCAGGACAAGACCGCGCTGGAGATCATCGAAGAC
CTCTTCGCCGATTACCCCGTCGCCCACTACAAGCTTGCCGTCAGCCAGCCGTGCGCCAAGCGCTCGATCT
GCTGCCAGTACCGCGAGACCGACTACGACTTCGTGATGCGCCTGCTGGCCGAGGAAGGCCTGTCGCTGCG
CATCGAGCACGAGCAGGGCGACGCACGGCGCGACGGCAGCGCGCAATCGCGCCACTGCGTGGTCATCTTC
GACAACGACGCCGAACGCCCCGCCTGCGCGCAGCCTGACATCCGCTTCCACCGCGTCGACGCCACCGAGC
GCGAGGACGCCATCGAGCGCTTCTCGCAGATGCGCACGGTCGGCACCAACGCCGTGACCGTCTCCTCGTG
GAACTACAAGGCCCTGGCCGCCACCGCCGCCCAGGCCAGCGCCAGCGACCCCGGCGGCGAACTGCCCGCG
CTCGAAGCGTTCGAGGCCGCCGGCCCCTATCGCTTTGCCGATGCCCAGGGCGCCGGCCGCGCCGCACGCC
TGCGCATGCAAGCCCACGAGGGCGCCTACCTGCGCTACCTCGGCCAGGGCAGCGTACGCCAGCTCGGCCC
CGGCCAGCGCTTCACGCTCACCCAACACTTCGACACCCGCCACAGCCAATTCGTCACCCTGTCGGTCGAG
CACGAGGCGGCCAACAACCTCGGTGCCGACCTCGCCCGGCTGCTCGGCACCACCGACATCGAATCGGGCC
GCTACCGCAACCGCTTCGTCGCCGTGCCGGCCGAGGCGCCGATCGTGCCCCCGTACCGCCACCGCCCCAC
CGCCCCCGAAGGCCAGGCCGCCACGGTGATCGCCGACGACGGTGCCCCGCTCACCACCGACCGTGACCAC
CGCGTGCGCATCCGCTTCCCGTGGCTGCGCGCGCCGGCGCTCAACGCCTTCGCCGAACCGGCCGGCAGCG
ACCGCTCGCAGGTCACCGCCTGGGTGCGCGTGGCCACCGCCTCGGCCGGCCCGAACTGGGGCGCGCACCA
CCTGCCGCGCGCCGGCACCCAGGTGCTGCTGACCTTCGTCGACGGCGACATCGACCGGCCGCTGGTCACC
ATGCAGCTGCACAACGAGCAGGACGCGCTGCCCTGGCCCGCCGCCGACGCGCCGCTCGGGCAGGCGCTGT
CGGGCTGGCACTCGCCGAGCCTGGGCGGCGACGGCTACAACCAGTGGGTGGTCGACGATCACCCCGCGCA
GCTGCGCATGCGGCTGGCCAGTTCCACCGCCGGCAGCCAGCTCAACCTCGGCTACGTGGTCTCGCACGGC
CCGACCGGCGGCGAGCGCGGCGACTGGCGCGGCACCGGCGCCGAACTGCGCACCGATGCGTGGGCGGTGG
TGCGCGCTGGCGGCGGCCTGCTGCTCTCGACCACCGCGCGAGCGCAGGCCGGCGGCACGCTGCTCGATAT
GCACGAGGCGCGCGGCCAACTCACGGCGGCACAGCGCACGGCACAGCGCCTGTCCGACGCGGCGGCCAGC
CAGCAGGCGCTGCCGTTGTCGGCCAACGCGGCCTTCGACCCGCTCACGCAGGCCCTCGACCCCGCCCAGG
ACGGGCACTACCCGAGCAGCGTCAACGGCCAGGACGCGACCCAGCCGAACCGGGCCCCGGTCGACAAGTT
CGCCCAGCCGCTGCTGGTGACCGAATCGCCCGCCAGCATCGCCCTGGCCTCGCAGGCCACCACCACGGTC
TACGCGGGTAGGCACCTGCACGGCACGGCGCAGGGCGACTGGCACCTGGCCGCCGGCAACGTGGTGGCAG
CGGCCGCGGCCCGGGGCGTGAGCCTGTTCGCGCAACGCAACGGCCTGCGCGCCATCGCCGAGGGCGGGCC
GGTCTCGATCCAGGCGCATACCGATGCGCTCGCGGTGCTGGCGGACCAGGCCGTCACCGTGATTTCCTCC
ACCGAGTCGATCGAGATCCTGGCGCAGCGCAACATCGTGCTGCGTGGCGGGGATTCGGTGATCCGGATGG
AGGGCAACGCGATTACGTTCGAGACGATCAAGCTGAGTGTGAAGGGGGCGGGGCATCCGTTGATTGGGCC
GGGTGGACGACCTTTCCGCATCGAGGGGCTACCAGATAGCCGCGTGAAACTCTTCGAGCAACAAATGCGC
GCCATTAACGAGCGCACTGGCGATCCGATAGCAAACCTACCCTACAAGATTGTCACCGAAGGCGGGGATG
TTCATTACGGGACAACGGACATCGAAGGTAAAACCATTCGCGTCCCAACAATTAAATCCGAAAAAGTTAC
GGTTTTTTGGGGCGAACTCCCTCCCTATAAATCATAA
 Primer design