SecReT6
Protein ID: 17548959
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0738
Locus tagRS01970
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]926494..929190 [-]
ProductVGR-related protein
NoteTssI
UniProt IDQ8XRU3
KEGG IDrso:RS01970
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.20E-64, Aligned region: 46..356
Phage_GPD [PF05954], Evalue: 4.20E-64, Aligned region: 660..763
DUF2345 [PF10106], Evalue: 3.20E-44, Aligned region: 667..818
T6SS_Vgr [PF13296], Evalue: 3.10E-35, Aligned region: 520..628
Phage_base_V [PF04717], Evalue: 5.80E-18, Aligned region: 416..502
Protein Sequence: 898 a.a.     [Download]
>gi|17548959|ref|NP_522299.1| RSp0738 gene product [Ralstonia solanacearum GMI1000]
MKSPFPLPAAVPQAVLGALLGQQTRQITLETALTSDNLVVERFTAREAVSASCVLQVDCLSPLANLDTAQ
LASQEATLRLMLADGSRRAWHGYVTDCAALGGNGGLARYRLRIGPWLDRLHTRRDCFVYQDKTALEIIED
LFADYPVAHYKLAVSQPCAKRSICCQYRETDYDFVMRLLAEEGLSLRIEHEQGDARRDGSAQSRHCVVIF
DNDAERPACAQPDIRFHRVDATEREDAIERFSQMRTVGTNAVTVSSWNYKALAATAAQASASDPGGELPA
LEAFEAAGPYRFADAQGAGRAARLRMQAHEGAYLRYLGQGSVRQLGPGQRFTLTQHFDTRHSQFVTLSVE
HEAANNLGADLARLLGTTDIESGRYRNRFVAVPAEAPIVPPYRHRPTAPEGQAATVIADDGAPLTTDRDH
RVRIRFPWLRAPALNAFAEPAGSDRSQVTAWVRVATASAGPNWGAHHLPRAGTQVLLTFVDGDIDRPLVT
MQLHNEQDALPWPAADAPLGQALSGWHSPSLGGDGYNQWVVDDHPAQLRMRLASSTAGSQLNLGYVVSHG
PTGGERGDWRGTGAELRTDAWAVVRAGGGLLLSTTARAQAGGTLLDMHEARGQLTAAQRTAQRLSDAAAS
QQALPLSANAAFDPLTQALDPAQDGHYPSSVNGQDATQPNRAPVDKFAQPLLVTESPASIALASQATTTV
YAGRHLHGTAQGDWHLAAGNVVAAAAARGVSLFAQRNGLRAIAEGGPVSIQAHTDALAVLADQAVTVISS
TESIEILAQRNIVLRGGDSVIRMEGNAITFETIKLSVKGAGHPLIGPGGRPFRIEGLPDSRVKLFEQQMR
AINERTGDPIANLPYKIVTEGGDVHYGTTDIEGKTIRVPTIKSEKVTVFWGELPPYKS
 
Nucleotide Sequence: 2697 bp     [Download]
>gi|17548221|ref|NC_003296.1|:c929190-926494 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGAAGTCACCGTTCCCCCTGCCGGCCGCCGTGCCGCAAGCCGTCCTGGGCGCGCTGCTCGGGCAGCAGA
CCCGCCAGATCACGCTGGAGACGGCGCTGACCTCCGACAACCTGGTGGTGGAACGCTTCACGGCGCGCGA
GGCGGTGTCGGCATCGTGCGTGCTGCAGGTCGATTGCCTGAGCCCCCTGGCTAACCTGGATACCGCCCAG
TTGGCTTCGCAGGAGGCCACGCTGCGCCTGATGCTCGCCGACGGCAGCCGCCGCGCCTGGCACGGCTACG
TGACCGACTGCGCGGCCCTCGGCGGCAACGGCGGGCTGGCGCGCTACCGCCTGCGCATCGGGCCCTGGCT
CGACCGCCTGCACACCCGCCGCGACTGCTTCGTCTACCAGGACAAGACCGCGCTGGAGATCATCGAAGAC
CTCTTCGCCGATTACCCCGTCGCCCACTACAAGCTTGCCGTCAGCCAGCCGTGCGCCAAGCGCTCGATCT
GCTGCCAGTACCGCGAGACCGACTACGACTTCGTGATGCGCCTGCTGGCCGAGGAAGGCCTGTCGCTGCG
CATCGAGCACGAGCAGGGCGACGCACGGCGCGACGGCAGCGCGCAATCGCGCCACTGCGTGGTCATCTTC
GACAACGACGCCGAACGCCCCGCCTGCGCGCAGCCTGACATCCGCTTCCACCGCGTCGACGCCACCGAGC
GCGAGGACGCCATCGAGCGCTTCTCGCAGATGCGCACGGTCGGCACCAACGCCGTGACCGTCTCCTCGTG
GAACTACAAGGCCCTGGCCGCCACCGCCGCCCAGGCCAGCGCCAGCGACCCCGGCGGCGAACTGCCCGCG
CTCGAAGCGTTCGAGGCCGCCGGCCCCTATCGCTTTGCCGATGCCCAGGGCGCCGGCCGCGCCGCACGCC
TGCGCATGCAAGCCCACGAGGGCGCCTACCTGCGCTACCTCGGCCAGGGCAGCGTACGCCAGCTCGGCCC
CGGCCAGCGCTTCACGCTCACCCAACACTTCGACACCCGCCACAGCCAATTCGTCACCCTGTCGGTCGAG
CACGAGGCGGCCAACAACCTCGGTGCCGACCTCGCCCGGCTGCTCGGCACCACCGACATCGAATCGGGCC
GCTACCGCAACCGCTTCGTCGCCGTGCCGGCCGAGGCGCCGATCGTGCCCCCGTACCGCCACCGCCCCAC
CGCCCCCGAAGGCCAGGCCGCCACGGTGATCGCCGACGACGGTGCCCCGCTCACCACCGACCGTGACCAC
CGCGTGCGCATCCGCTTCCCGTGGCTGCGCGCGCCGGCGCTCAACGCCTTCGCCGAACCGGCCGGCAGCG
ACCGCTCGCAGGTCACCGCCTGGGTGCGCGTGGCCACCGCCTCGGCCGGCCCGAACTGGGGCGCGCACCA
CCTGCCGCGCGCCGGCACCCAGGTGCTGCTGACCTTCGTCGACGGCGACATCGACCGGCCGCTGGTCACC
ATGCAGCTGCACAACGAGCAGGACGCGCTGCCCTGGCCCGCCGCCGACGCGCCGCTCGGGCAGGCGCTGT
CGGGCTGGCACTCGCCGAGCCTGGGCGGCGACGGCTACAACCAGTGGGTGGTCGACGATCACCCCGCGCA
GCTGCGCATGCGGCTGGCCAGTTCCACCGCCGGCAGCCAGCTCAACCTCGGCTACGTGGTCTCGCACGGC
CCGACCGGCGGCGAGCGCGGCGACTGGCGCGGCACCGGCGCCGAACTGCGCACCGATGCGTGGGCGGTGG
TGCGCGCTGGCGGCGGCCTGCTGCTCTCGACCACCGCGCGAGCGCAGGCCGGCGGCACGCTGCTCGATAT
GCACGAGGCGCGCGGCCAACTCACGGCGGCACAGCGCACGGCACAGCGCCTGTCCGACGCGGCGGCCAGC
CAGCAGGCGCTGCCGTTGTCGGCCAACGCGGCCTTCGACCCGCTCACGCAGGCCCTCGACCCCGCCCAGG
ACGGGCACTACCCGAGCAGCGTCAACGGCCAGGACGCGACCCAGCCGAACCGGGCCCCGGTCGACAAGTT
CGCCCAGCCGCTGCTGGTGACCGAATCGCCCGCCAGCATCGCCCTGGCCTCGCAGGCCACCACCACGGTC
TACGCGGGTAGGCACCTGCACGGCACGGCGCAGGGCGACTGGCACCTGGCCGCCGGCAACGTGGTGGCAG
CGGCCGCGGCCCGGGGCGTGAGCCTGTTCGCGCAACGCAACGGCCTGCGCGCCATCGCCGAGGGCGGGCC
GGTCTCGATCCAGGCGCATACCGATGCGCTCGCGGTGCTGGCGGACCAGGCCGTCACCGTGATTTCCTCC
ACCGAGTCGATCGAGATCCTGGCGCAGCGCAACATCGTGCTGCGTGGCGGGGATTCGGTGATCCGGATGG
AGGGCAACGCGATTACGTTCGAGACGATCAAGCTGAGTGTGAAGGGGGCGGGGCATCCGTTGATTGGGCC
GGGTGGACGACCTTTCCGCATCGAGGGGCTACCAGATAGCCGCGTGAAACTCTTCGAGCAACAAATGCGC
GCCATTAACGAGCGCACTGGCGATCCGATAGCAAACCTACCCTACAAGATTGTCACCGAAGGCGGGGATG
TTCATTACGGGACAACGGACATCGAAGGTAAAACCATTCGCGTCCCAACAATTAAATCCGAAAAAGTTAC
GGTTTTTTGGGGCGAACTCCCTCCCTATAAATCATAA
 Primer design

Protein ID: 17548971
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0750
Locus tagRS01958
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]941920..944676 [+]
ProductVGR-related protein
NoteTssI
UniProt IDQ8XRT1
KEGG IDrso:RS01958
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-69, Aligned region: 42..362
DUF2345 [PF10106], Evalue: 8.20E-40, Aligned region: 542..583
DUF2345 [PF10106], Evalue: 8.20E-40, Aligned region: 625..680
DUF2345 [PF10106], Evalue: 8.20E-40, Aligned region: 724..885
T6SS_Vgr [PF13296], Evalue: 3.10E-25, Aligned region: 585..689
T6SS_Vgr [PF13296], Evalue: 3.10E-25, Aligned region: 772..780
Phage_base_V [PF04717], Evalue: 3.70E-19, Aligned region: 430..532
Protein Sequence: 918 a.a.     [Download]
>gi|17548971|ref|NP_522311.1| RSp0750 gene product [Ralstonia solanacearum GMI1000]
MVSPTELANLLRAAFTQANRLLRLDTPLGPNALLPERLDVAEHLDDGGFRLELTALSDDADLDPARLLGQ
PVRLDLLTQQSRGALRPFHGHVTRFEQLGANGGLVRYRLVIEPWLAFLRHRRDSFLFQDQSVIEVIDSLF
GDYNGQGRLAPAWRWSLRDASVYTRRSVITQYEESDFDFVTRLLAEEGLFYFFEHEAVEGDALGVHRMVI
ADANDVFTDNAQAAIRFGRADATANEDVIDRWQGVRRWQTNAVSIASWDYRANTQRSAQLGAQQWRDGIP
QLTLQDTDYPGQYWFEDSAQAQRSARLVMEALELRDKQFDGEGSVRTLALGTRFQLVDHYEHGDDGEARF
AVLSVLHRARNNFNERFGQVLTQALGALSGADAQDAAGNAGTDATFYRNHFTVVHDTVPYRPQQRDAQGR
ALHPRPTVEGSQTALVVGTGGPVHTDRDHRIKVQFHWQRGARSASRQPHPAGDDNARAEAGLGCWVRVAA
PVAGPNWGGVALPRVGQEVLVEFVQGDIDRPVVVGAAYNGSGQRDAQYNQNQAGAAGATGNAPAWFAGDS
KSQGAYAHNAVLSGIKTQALAGSQTGASGYSQLVFDDTEGQGRTQLSTTQAATALTLGHQKEQIDSARQA
DLGHGAALATNDSGSVRAGAGLLLTAHAADTGAALLDSEGAASQIEALSELAESLADVARKQQAGLPEEP
AAQDLPALKQLRHTTEVLRHAESAGKGASAIAYSEPHLQVSAPKGIAATTPADAVLVAGTQIALAAKQDA
NLAAGGNLAMAVADGLTLFAHGKAVGQSSDAARGIAMHAASGKVSLSALKGESRLVAEKAVTVASTQGNV
TAEGKARVLVNAAGAQIRVTNGTIELHAPGKTIFKGAGHVFVGPGGGAVSNTLAQGNLKGCGTQEGNAAT
KGTGSISR
 
Nucleotide Sequence: 2757 bp     [Download]
>gi|17548221|ref|NC_003296.1|:941920-944676 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGGTCTCACCGACCGAGCTGGCCAACCTGCTGCGGGCCGCCTTCACGCAGGCCAATCGGCTGCTGCGCC
TGGATACGCCGCTCGGGCCGAACGCGCTGCTGCCCGAGCGGTTGGACGTCGCCGAGCATCTCGACGATGG
CGGCTTCCGGCTGGAGCTGACCGCGCTGTCGGATGACGCCGATCTCGATCCGGCGCGCCTGCTGGGGCAG
CCCGTCCGGCTCGACCTGCTGACCCAGCAGAGCCGCGGCGCGCTGCGGCCGTTCCATGGCCACGTCACGC
GGTTCGAGCAGTTGGGCGCCAACGGCGGCCTGGTGCGCTACCGGCTGGTGATCGAACCCTGGCTGGCCTT
CCTGCGCCACCGGCGCGACAGCTTCCTGTTCCAGGACCAGTCGGTGATCGAAGTGATCGACAGCCTGTTC
GGCGACTACAACGGCCAGGGCCGCCTGGCGCCGGCGTGGCGCTGGTCGCTGCGCGATGCCTCGGTGTACA
CGCGCCGCAGCGTCATCACGCAATACGAAGAAAGCGATTTCGACTTCGTCACCCGCCTGCTGGCCGAGGA
AGGGCTGTTCTACTTCTTCGAGCACGAGGCGGTCGAGGGCGATGCGCTGGGCGTGCACCGCATGGTGATC
GCCGATGCCAACGATGTCTTCACCGACAACGCGCAGGCCGCGATCCGCTTCGGCCGCGCCGATGCCACCG
CCAATGAAGACGTGATCGACCGCTGGCAGGGCGTGCGGCGCTGGCAGACCAACGCCGTGTCGATCGCCAG
TTGGGACTACCGCGCCAACACCCAGCGCAGCGCCCAGCTCGGCGCGCAGCAGTGGCGCGACGGCATCCCG
CAACTGACGCTGCAGGACACCGACTACCCCGGCCAGTACTGGTTCGAAGACAGCGCCCAGGCCCAGCGCA
GCGCGCGCCTGGTGATGGAAGCGCTGGAGCTGCGCGACAAGCAGTTCGACGGCGAAGGCAGCGTGCGCAC
GCTGGCGCTGGGCACGCGCTTCCAACTGGTTGATCATTATGAGCACGGCGACGACGGCGAGGCGCGCTTC
GCCGTGCTGTCCGTCCTGCACCGGGCACGCAACAACTTCAACGAGCGCTTTGGCCAGGTGCTGACGCAGG
CGCTGGGCGCGCTGTCCGGCGCCGACGCGCAAGACGCCGCGGGCAACGCGGGCACCGACGCCACGTTTTA
CCGTAACCACTTCACGGTCGTGCACGATACCGTGCCGTACCGCCCGCAGCAGCGCGATGCGCAGGGCCGT
GCGCTGCATCCGCGTCCGACGGTCGAGGGCAGCCAGACCGCACTGGTGGTGGGCACCGGTGGCCCGGTGC
ATACGGACCGCGATCATCGCATCAAGGTCCAGTTCCATTGGCAGCGCGGCGCACGCTCGGCCAGTCGGCA
GCCGCATCCGGCCGGCGATGACAACGCCCGCGCGGAGGCCGGCCTGGGCTGCTGGGTGCGCGTGGCGGCG
CCGGTGGCCGGGCCCAACTGGGGCGGCGTGGCGTTGCCGCGCGTGGGCCAGGAAGTGCTGGTGGAATTCG
TGCAGGGCGATATCGACCGGCCGGTGGTGGTGGGCGCGGCCTATAACGGCAGCGGCCAGCGCGACGCGCA
GTACAACCAGAACCAGGCCGGCGCGGCGGGCGCGACCGGCAACGCGCCGGCCTGGTTTGCCGGCGACAGC
AAGAGCCAGGGGGCGTACGCGCACAACGCGGTGCTCTCCGGCATCAAGACGCAGGCGCTGGCCGGCAGCC
AGACGGGCGCCTCGGGTTACAGCCAGCTCGTGTTCGACGATACCGAGGGCCAGGGCCGCACGCAGCTGAG
CACCACCCAGGCCGCCACCGCGCTCACGCTGGGGCACCAGAAGGAACAGATCGACAGCGCCCGCCAGGCC
GACCTAGGACACGGCGCGGCGCTGGCCACCAACGACAGCGGCAGCGTGCGCGCCGGCGCGGGCCTGCTGC
TCACCGCGCACGCCGCCGACACCGGCGCCGCGCTTCTCGACAGCGAAGGCGCCGCCAGCCAGATCGAAGC
CCTCAGCGAACTGGCCGAATCGCTGGCCGACGTGGCCCGGAAGCAGCAGGCCGGCCTGCCGGAAGAGCCT
GCCGCGCAAGACCTGCCCGCGCTCAAGCAACTGCGGCACACCACCGAAGTGCTGCGCCACGCGGAAAGCG
CAGGCAAAGGCGCCTCGGCCATCGCCTACAGCGAACCGCATCTGCAAGTCAGCGCGCCGAAGGGGATTGC
CGCGACCACGCCGGCCGACGCCGTGCTGGTGGCCGGCACCCAGATCGCATTGGCGGCCAAGCAGGACGCC
AACCTCGCGGCGGGCGGCAACCTGGCAATGGCCGTGGCCGACGGCCTGACCCTGTTCGCGCACGGCAAGG
CGGTGGGCCAGTCATCCGACGCGGCCCGGGGCATCGCGATGCATGCGGCGAGCGGCAAGGTGAGCTTGAG
CGCCCTGAAGGGCGAGAGCCGGCTGGTGGCCGAGAAAGCCGTCACGGTGGCATCCACGCAGGGCAATGTC
ACGGCGGAGGGCAAGGCGCGCGTGCTGGTGAATGCGGCGGGCGCGCAGATCCGGGTGACCAACGGGACGA
TTGAGCTGCATGCGCCGGGGAAGACGATCTTCAAGGGGGCGGGGCATGTGTTTGTGGGGCCGGGTGGGGG
GGCGGTGAGCAATACGCTGGCCCAGGGCAATCTGAAGGGTTGCGGCACCCAGGAAGGTAATGCCGCAACG
AAAGGCACAGGGTCGATTTCGCGCTGA
 Primer design

Protein ID: 17548989
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0768
Locus tagRS01940
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]968930..971950 [+]
ProductVGR-related protein
NoteTssI
UniProt IDQ8XRR3
KEGG IDrso:RS01940
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-56, Aligned region: 37..354
Phage_GPD [PF05954], Evalue: 1.80E-56, Aligned region: 727..771
DUF2345 [PF10106], Evalue: 8.40E-41, Aligned region: 768..929
T6SS_Vgr [PF13296], Evalue: 3.30E-34, Aligned region: 614..724
T6SS_Vgr [PF13296], Evalue: 3.30E-34, Aligned region: 887..909
T6SS_Vgr [PF13296], Evalue: 3.30E-34, Aligned region: 964..990
Phage_base_V [PF04717], Evalue: 4.40E-20, Aligned region: 450..549
Protein Sequence: 1006 a.a.     [Download]
>gi|17548989|ref|NP_522329.1| RSp0768 gene product [Ralstonia solanacearum GMI1000]
MDVTTLLQNLFAPAHRLYALEGEGPIAELAVEAWLGREALSELFEWRVVAASANARFALESFIGQRVTLV
TTLADGTQARRTGLIRQAEQLGADGSLARYRLTVVPWFWLATQQRHSQVFQNRPLADILEQVLSPYAPYA
AWRFAAGAEDRMAAFGTRSHIAQFRETDYRFVTRLLAEAGLGFTTVEDEQAPSGHALLIFADSPRLAEDT
ASAAEGGIRYHRAHSQEERDAIQALICHSRTAVGGVAVAAWDAQAKRAFRAHVPSRFCGIAGSPDAYLSI
SPSLAPDTANAQRIAEQVMESVEARARLFIGRGSVRTLRSGTRLKIVDCPHLPKDVDGPYPLLIDLVEHC
GINNLTADTQATLARKLGGLDAALTFDTPPSPPESGPGPFGFMAPHEVIERFTPTADLLTAARAHGYAGQ
FRAGDARRPWRPVVSHPDTGRLYAEPTAKGVHTAIVVGPNGETEASGDAEHHTTPRGQVRVRFPWQQGER
PDDRSTGWLLVAQRQAGAGMGWQWLPRIGQEVLVKFQEDDIDQPVVIGALYNGQGEAGIAPTPGGQVAKG
VRQEADPETLYRLGSDSAASAQGNLAAGHSPAWHGLGTEAEGHRNAAALSGFKSAEHGGRGANLLVFDDS
DGQLRTQLATTQAYSQLNLGHLIHQQDNRRGSFRGQGFELRTDGYGAVRGHAGVLLTTYRDATSGKAVPT
GDNAAGIALIRQAKQLTSSLSQGATTHQTAALSTAKDDSAPLAQQEKAASGMVDGKALDAARQDAAAGNT
TTQGKVPHQSDATVQLAGRAGLVAIAGQDLQFASGESIALASGQDTNVAVGKQARLHAGQGIGVAAGLSK
AGDDNIGLQLTAGQDNLDVQAQHDALGLLSKDDLKLVSANLHVDFAAAKRIRLATAAGASITLEGGNIIV
ETPGRITYKAAQRSFAGPTHASRELNTWSHSAFDDRYVLRDQVTHEPLRNTQVELRRGDGAVLKLVTDGE
GRLPVQKGISMERVQLRVLGTLSGKT
 
Nucleotide Sequence: 3021 bp     [Download]
>gi|17548221|ref|NC_003296.1|:968930-971950 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGGACGTAACGACCCTTCTCCAGAACCTCTTCGCTCCCGCGCACCGCCTGTACGCGCTGGAAGGCGAAG
GCCCGATCGCGGAGCTGGCGGTGGAGGCGTGGCTCGGTCGCGAGGCGTTGTCCGAGCTGTTCGAATGGCG
GGTGGTAGCGGCCAGCGCCAATGCGCGCTTCGCCCTCGAATCGTTCATCGGCCAGCGCGTGACGCTGGTC
ACCACGCTGGCCGACGGCACGCAGGCCCGGCGCACCGGCCTGATCCGGCAGGCCGAGCAGCTTGGCGCCG
ATGGCAGCCTCGCGCGCTATCGCCTGACCGTGGTGCCGTGGTTCTGGCTCGCCACCCAACAGCGGCACAG
CCAGGTGTTCCAGAACCGGCCGCTGGCGGACATCCTCGAACAGGTGCTGTCGCCGTATGCGCCCTATGCC
GCATGGCGCTTCGCCGCCGGCGCGGAAGACCGCATGGCGGCGTTCGGCACGCGTAGCCACATCGCTCAGT
TTCGCGAGACCGACTACCGCTTCGTCACGCGCCTGCTGGCCGAGGCGGGTCTGGGCTTCACCACCGTCGA
GGACGAGCAGGCCCCCAGCGGCCACGCGCTGCTGATCTTTGCCGACAGCCCCCGGCTGGCCGAGGACACG
GCATCCGCTGCCGAGGGCGGCATCCGCTACCACCGCGCGCACAGCCAGGAAGAACGCGACGCCATCCAGG
CGTTGATCTGCCATAGCCGCACAGCGGTCGGCGGAGTGGCGGTGGCGGCCTGGGATGCGCAGGCCAAGCG
GGCCTTCCGCGCGCACGTTCCCTCCCGGTTTTGCGGTATCGCGGGCAGCCCGGATGCCTATCTGTCGATC
AGCCCGTCGCTGGCGCCGGATACGGCCAACGCGCAGCGCATCGCCGAGCAGGTGATGGAGAGCGTCGAAG
CGCGCGCTCGCCTGTTCATCGGACGCGGCTCGGTGCGCACGCTGCGCAGCGGCACGCGACTGAAGATCGT
GGACTGCCCGCACCTGCCGAAGGACGTGGACGGCCCGTATCCGTTGCTGATCGACCTGGTGGAGCACTGC
GGCATCAACAACCTGACCGCCGATACGCAGGCAACATTGGCCCGGAAGCTGGGCGGGCTCGACGCCGCAC
TGACCTTCGACACGCCGCCCAGCCCCCCCGAATCCGGCCCCGGCCCGTTCGGCTTCATGGCGCCACACGA
GGTCATCGAACGCTTCACGCCGACGGCGGACCTGCTCACCGCTGCGCGCGCCCACGGCTACGCCGGCCAA
TTCCGCGCGGGTGACGCACGCCGGCCGTGGCGACCGGTCGTGTCGCATCCCGACACCGGCCGCCTGTACG
CCGAGCCCACCGCCAAGGGCGTACACACGGCCATCGTGGTCGGCCCGAACGGCGAGACCGAGGCCAGTGG
CGATGCGGAGCACCACACCACTCCACGGGGCCAGGTCCGCGTCCGCTTCCCGTGGCAGCAGGGCGAACGT
CCGGATGACCGCAGCACCGGCTGGCTGCTGGTCGCGCAGCGGCAGGCTGGGGCCGGCATGGGCTGGCAGT
GGCTGCCGCGCATCGGCCAGGAAGTGTTGGTCAAGTTCCAGGAAGACGATATCGACCAGCCGGTGGTGAT
CGGCGCGCTCTACAACGGCCAGGGCGAAGCGGGCATCGCGCCGACCCCGGGCGGGCAGGTCGCCAAGGGC
GTCAGGCAGGAGGCCGACCCGGAGACCCTCTACCGTTTGGGCAGCGACAGCGCCGCCAGCGCGCAGGGCA
ACCTCGCCGCCGGCCACAGCCCCGCATGGCACGGCCTGGGCACCGAGGCCGAAGGCCACCGCAACGCCGC
CGCCCTCAGCGGCTTCAAGAGCGCCGAGCATGGCGGGCGCGGCGCCAACCTGCTCGTCTTCGACGACAGC
GACGGGCAGTTGCGCACGCAGCTCGCCACCACGCAGGCTTACAGCCAACTCAACCTGGGCCACCTGATCC
ACCAGCAGGACAACCGGCGCGGCAGCTTCCGGGGCCAGGGCTTCGAGTTGCGCACCGATGGCTATGGCGC
GGTGCGCGGCCACGCCGGTGTGCTGCTGACCACCTACCGCGATGCCACGAGCGGCAAGGCTGTGCCGACC
GGCGACAACGCCGCCGGCATCGCGCTGATCCGGCAGGCCAAGCAACTGACGTCATCGTTGAGCCAGGGCG
CCACTACGCACCAGACCGCAGCGCTGTCCACCGCGAAGGACGACAGCGCACCGCTGGCCCAGCAGGAAAA
GGCCGCCTCGGGCATGGTCGACGGCAAAGCGCTCGATGCGGCCCGGCAGGACGCGGCCGCAGGCAACACC
ACCACGCAAGGCAAGGTGCCGCACCAGAGCGATGCGACTGTGCAGCTGGCCGGCCGCGCGGGCCTGGTGG
CGATCGCCGGGCAGGATCTGCAATTCGCCAGCGGCGAGAGCATCGCACTGGCCAGCGGCCAGGACACCAA
CGTCGCGGTGGGCAAGCAGGCGCGCCTCCACGCGGGGCAGGGCATCGGCGTGGCAGCGGGGCTGTCGAAG
GCGGGGGACGACAACATCGGCCTGCAGCTGACGGCGGGGCAGGACAACCTCGACGTGCAGGCGCAGCATG
ACGCGCTCGGGCTGCTGTCCAAGGACGACCTGAAGCTGGTGTCGGCGAATCTGCATGTGGACTTCGCGGC
GGCCAAGCGGATCCGGCTGGCGACGGCGGCGGGGGCGTCGATCACGCTGGAGGGCGGAAACATCATCGTC
GAGACGCCGGGGCGGATTACGTACAAGGCGGCGCAGCGCAGCTTTGCGGGGCCCACGCACGCGTCGCGCG
AGCTGAACACGTGGTCGCACAGTGCGTTTGACGATCGATATGTTTTGCGCGACCAAGTCACGCACGAGCC
GCTGCGGAATACGCAGGTCGAATTGCGGCGCGGTGACGGTGCTGTACTCAAGCTGGTCACCGATGGAGAG
GGCCGCCTCCCTGTGCAGAAGGGTATTTCCATGGAGCGTGTGCAACTGCGCGTGCTGGGAACGCTCTCCG
GCAAAACCTAA
 Primer design