SecReT6
Protein ID: 17548960
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0739
Locus tagRS01969
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]929249..930040 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ8XRU2
KEGG IDrso:RS01969
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.60E-57, Aligned region: 33..234
Protein Sequence: 263 a.a.     [Download]
>gi|17548960|ref|NP_522300.1| RSp0739 gene product [Ralstonia solanacearum GMI1000]
MSATTTPSLFGGSAAPAGNAAADARESNTHVRTLLDLLYDGFFMLFQLRNGQQPTSAEDFLTRVRAFLED
FDRGAKRLNVSAEDVFDAKYAFCAAVDETILSSNFSIRTAWERRPLQLELFGEQLAGETFFIKLEELRAH
GAPRLQALEVFHMCLLLGFRGKYILEGPEKLAYLTARLGDEISAIKGKRAAFAPHWLLPDKVSHRLKRET
PLWIFGAVFALIALLGYIGLSSTLRAKTNETLEGYSQVIKLGPRFSHLTISLP
 
Nucleotide Sequence: 792 bp     [Download]
>gi|17548221|ref|NC_003296.1|:c930040-929249 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGAGCGCTACCACCACGCCTTCGCTGTTCGGCGGCTCGGCCGCCCCCGCCGGCAATGCCGCAGCCGATG
CGCGCGAATCCAACACGCACGTGCGCACGCTGCTGGACCTGCTCTACGATGGCTTCTTCATGCTCTTCCA
GCTGCGCAACGGCCAGCAGCCGACCAGCGCGGAAGACTTCCTCACCCGCGTGCGCGCCTTCCTGGAAGAT
TTCGACCGCGGCGCCAAGCGGCTGAACGTGTCGGCCGAAGACGTGTTCGACGCCAAGTACGCGTTCTGCG
CCGCCGTGGACGAGACCATCCTGTCGTCCAACTTCTCCATCCGTACCGCCTGGGAGCGCCGTCCGCTGCA
GCTGGAGCTGTTCGGCGAGCAGCTCGCCGGTGAAACGTTCTTCATCAAGCTGGAAGAGCTGCGTGCCCAC
GGCGCGCCGCGCCTGCAGGCCCTGGAGGTCTTCCACATGTGCCTGCTGCTGGGCTTCCGCGGCAAGTACA
TCCTCGAAGGGCCGGAGAAGCTGGCCTACCTGACCGCCCGCCTGGGCGACGAGATCTCCGCCATCAAGGG
CAAGCGCGCGGCCTTCGCGCCGCACTGGCTGCTGCCGGACAAGGTGTCGCACCGGCTCAAGCGCGAAACG
CCGCTGTGGATCTTCGGCGCGGTCTTCGCGCTGATCGCGCTGCTGGGGTACATCGGCCTGTCGTCCACGC
TGCGCGCGAAGACGAACGAAACGCTGGAAGGCTATTCGCAGGTCATCAAGCTCGGGCCGCGCTTCTCGCA
CCTGACCATCTCGCTGCCCTGA
 Primer design