SecReT6
Protein ID: 17548961
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0740
Locus tagRS01968
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]930037..931383 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ8XRU1
KEGG IDrso:RS01968
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.00E-132, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|17548961|ref|NP_522301.1| RSp0740 gene product [Ralstonia solanacearum GMI1000]
MSYSAKILWGEGLFLRPQHFQRQDAYHESRLHATAQMIQPYGWGIRHAQFDTDALASGVLRATELSLFFP
DGELYFAPQADTLPPPLVLDAIPAGVSELTFHLALYPLQDSGGNYREQLEGTTVSRFVSTEAETADLFTE
AESAAITYLKKSVKLVADTEPRDQFIALPIVRVRRTGTGGFELDDSFVAPSLSINASAVLYVRLRRLLDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTANAAFAALSHLYHHPDLHPERLFQEMLRLAGALMT
FTKSYTLADLPAYDHDKPGPVFSRLDTIVRELLDTVISTRYFAIALEETRPSFHLGRIDSGKIDDKTSFY
LSVSADMPAAELVEAIPARFKVGAPDDVDKLVLSSMPGVPLTYTPQVPPAIPVRPGACYFAVEARGMLYE
RMLQAQTITIYAPAGIRELKLELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|17548221|ref|NC_003296.1|:c931383-930037 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
GTGAGCTATTCCGCCAAAATCCTCTGGGGCGAAGGGCTGTTCCTGCGGCCCCAGCACTTCCAGCGCCAGG
ACGCGTACCACGAGTCCCGCCTGCATGCGACCGCGCAGATGATCCAGCCGTACGGATGGGGCATCCGCCA
TGCGCAGTTCGACACCGATGCCCTCGCCAGCGGCGTGCTGCGCGCGACCGAGCTGTCGCTGTTCTTTCCG
GACGGCGAGCTGTACTTCGCGCCGCAGGCCGATACCCTGCCGCCGCCGCTCGTGCTCGACGCCATCCCGG
CCGGTGTGTCGGAGCTGACCTTCCACCTCGCGCTCTATCCGCTGCAGGACAGCGGCGGCAACTACCGCGA
GCAGCTTGAGGGCACCACCGTGTCGCGCTTCGTCTCCACCGAAGCAGAAACGGCGGACCTGTTCACCGAG
GCCGAGTCCGCGGCCATCACCTACCTCAAGAAGTCGGTGAAGCTGGTGGCGGACACCGAGCCGCGCGACC
AGTTCATCGCGCTGCCCATCGTGCGGGTGCGCCGGACGGGCACCGGCGGCTTCGAGCTGGACGACAGCTT
CGTCGCGCCGAGCCTGTCGATCAATGCGTCCGCCGTGCTGTACGTGCGCCTGCGCCGGCTGCTGGACGCG
CTGCAGGCCAAGGTCAACGCGCTGTACGGCTTCCACCGCGAGCCGACCAAGAACATCATCGAATTCCGCT
CGGGCGATATTGCATCGTTCTGGCTGCTGCACACCGCCAATGCCGCCTTTGCGGCGCTGTCGCACCTCTA
TCACCACCCGGACCTGCATCCGGAGCGGCTGTTCCAGGAGATGCTGCGCCTGGCCGGCGCACTGATGACG
TTCACCAAGAGCTACACCCTGGCCGACCTGCCCGCCTACGACCACGACAAACCCGGCCCGGTGTTCTCGC
GGCTGGACACCATCGTGCGCGAGCTGCTCGATACCGTGATCTCCACGCGCTACTTCGCGATCGCGCTGGA
GGAGACGCGGCCCTCGTTCCATCTCGGCCGGATCGACTCCGGCAAGATCGACGACAAGACCAGCTTCTAC
CTCTCGGTGTCGGCCGACATGCCGGCGGCGGAACTGGTGGAGGCGATTCCCGCGCGCTTCAAGGTCGGCG
CGCCGGACGACGTGGACAAGCTGGTGCTGTCGTCCATGCCGGGCGTGCCGCTCACCTACACGCCGCAGGT
GCCGCCCGCCATTCCGGTGCGGCCGGGCGCGTGCTACTTCGCGGTCGAAGCGCGCGGCATGCTGTACGAA
CGCATGCTGCAGGCCCAGACCATCACCATCTATGCCCCGGCCGGTATCCGGGAACTCAAACTTGAACTCA
TCGCGGTGACTTCATGA
 Primer design