SecReT6
Protein ID: 17548962
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0741
Locus tagRS01967
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]931427..932008 [-]
Producttransmembrane protein
NoteTssJ
UniProt IDQ8XRU0
KEGG IDrso:RS01967
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.90E-37, Aligned region: 4..163
Protein Sequence: 193 a.a.     [Download]
>gi|17548962|ref|NP_522302.1| RSp0741 gene product [Ralstonia solanacearum GMI1000]
MAVIALTACSTGASVLAGAASGALEAVGLKASNVPDAQKPPREVPLKLTAGANLNAATDRRPVALVVRLY
ALKDPTSFLQAPYDTFIDPAREKQTLGADLVQVREMTLIPGQRYEFSEKVSREASTLGVVALFRSPAAQR
WKFAFNAEKNEKSGIMIGLHACAMTLTTGSPTTPAGSAPLSDLNLLSPASCGG
 
Nucleotide Sequence: 582 bp     [Download]
>gi|17548221|ref|NC_003296.1|:c932008-931427 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGGCCGTGATCGCCCTGACCGCCTGCTCGACCGGCGCCAGCGTGCTGGCGGGCGCCGCCAGTGGCGCGC
TGGAGGCCGTGGGGCTGAAGGCATCGAACGTGCCGGACGCGCAGAAACCGCCCCGCGAGGTTCCGCTCAA
GCTGACCGCCGGCGCCAACCTGAACGCGGCGACGGACCGCCGCCCGGTCGCGCTGGTGGTCCGGTTATAC
GCACTCAAGGATCCGACCAGTTTCCTGCAGGCGCCGTATGACACGTTTATTGATCCGGCGCGTGAAAAAC
AAACGCTCGGCGCCGATCTGGTCCAGGTCCGGGAAATGACGCTGATTCCCGGCCAGCGCTACGAATTCTC
GGAAAAAGTCTCGCGTGAAGCCAGTACACTGGGCGTTGTTGCACTATTCCGCAGTCCGGCCGCCCAACGA
TGGAAATTCGCTTTTAATGCGGAAAAGAATGAGAAAAGCGGCATCATGATCGGATTGCACGCTTGCGCGA
TGACCCTGACCACGGGCTCGCCGACCACCCCCGCCGGCAGCGCGCCGCTGTCCGACCTGAACCTGCTTTC
GCCGGCAAGCTGCGGCGGCTGA
 Primer design