SecReT6
Protein ID: 17548964
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0743
Locus tagRS01965
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]933060..933572 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ8XRT8
KEGG IDrso:RS01965
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-59, Aligned region: 11..162
Protein Sequence: 170 a.a.     [Download]
>gi|17548964|ref|NP_522304.1| RSp0743 gene product [Ralstonia solanacearum GMI1000]
MAKKESVQKRLQKVRPPRVQLTYDVEKGDAIEQKELPFVVGVVADLSGQSEVAQPKLRDRKFVNIDRDNF
DDVMSAAEPRAAFQVQNTLTEEGGRFGVDLKFRSLEDFSPEAVVNQIEPLRQLLEARSKLADLRNKLAGN
DKLEDLLSEVLNNTEALQKLGVKTDGGEDA
 
Nucleotide Sequence: 513 bp     [Download]
>gi|17548221|ref|NC_003296.1|:933060-933572 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGGCTAAGAAAGAAAGTGTGCAGAAGCGTCTGCAGAAGGTGCGCCCCCCGCGCGTGCAGCTGACGTACG
ACGTTGAAAAGGGCGACGCGATCGAGCAGAAGGAACTGCCGTTCGTGGTCGGCGTGGTGGCGGACCTGTC
GGGCCAGTCGGAAGTGGCGCAGCCCAAGCTGCGCGACCGCAAGTTCGTCAACATCGACCGCGACAACTTC
GACGACGTGATGTCGGCGGCCGAGCCGCGCGCTGCCTTTCAGGTGCAGAACACGCTGACGGAAGAGGGCG
GCCGCTTCGGCGTCGACCTCAAGTTCCGCTCGCTGGAGGATTTCTCGCCGGAAGCCGTGGTGAACCAGAT
CGAGCCGCTGCGCCAGCTGCTGGAGGCACGCTCCAAGCTGGCCGACCTGCGCAACAAGCTGGCCGGCAAC
GACAAGCTGGAAGATCTGCTGTCCGAGGTGCTGAACAACACCGAGGCCCTGCAGAAGCTGGGTGTCAAGA
CGGATGGGGGTGAGGATGCTTGA
 Primer design