SecReT6
Protein ID: 17548965
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0744
Locus tagRS01964
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]933565..935055 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ8XRT7
KEGG IDrso:RS01964
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-192, Aligned region: 68..491
Protein Sequence: 496 a.a.     [Download]
>gi|17548965|ref|NP_522305.1| RSp0744 gene product [Ralstonia solanacearum GMI1000]
MLDNQSAALAQSAPAAESVNLLDEIVEQSRVAKSDAEHARAKDIIGELVNQVLQGTVVVSDNLSATLDAR
VAELDRLISSQLSAVMHTPEFQKLEGTWRGLSYLVKETQTSTMLKIKVLNATKRDLVRDFKTAIDFDQSA
LFKKVYEEEFGTFGGAPFGTLIGDFEVTRQPEDVYFIEQMSHVAAAAHAPFIASSSPELFGLESFADLGK
PRDLAKVFDTVEYAKWKSFRESEDSRYVGLTMPRFLGRLPYNPKDGTTVEGFNFVEDVDGTDHSKYLWCN
AAWAFGARLTAAFEDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQRPKKYDTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAKNV
ETFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEVPGKPGTYRSVAFLRPHFQLDELSISLRLVADL
PKPTNS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|17548221|ref|NC_003296.1|:933565-935055 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGCTTGACAACCAATCCGCCGCGCTCGCGCAGAGCGCACCGGCAGCCGAGTCCGTCAACCTGCTCGACG
AGATCGTCGAGCAGAGCCGCGTCGCCAAGTCGGACGCCGAGCACGCGCGCGCCAAGGACATCATCGGCGA
GCTGGTCAACCAGGTGCTGCAGGGCACGGTGGTGGTGTCCGACAACCTGTCGGCCACGCTGGATGCCCGC
GTGGCCGAGCTGGACCGCCTGATCTCGTCGCAGCTGAGCGCCGTCATGCACACGCCCGAGTTCCAGAAGC
TGGAGGGCACGTGGCGCGGCCTGTCGTACCTGGTCAAGGAAACGCAGACCAGCACGATGCTCAAGATCAA
GGTGCTCAACGCCACCAAGCGCGATCTCGTGCGCGACTTCAAGACGGCCATCGATTTCGACCAGAGCGCG
CTGTTCAAGAAGGTGTACGAAGAAGAATTCGGCACCTTCGGCGGCGCGCCGTTCGGCACGCTGATCGGCG
ATTTCGAAGTCACGCGCCAGCCGGAAGACGTGTACTTCATCGAGCAGATGTCGCACGTGGCGGCGGCCGC
GCATGCGCCGTTCATCGCCTCGTCGTCGCCGGAGCTGTTCGGCCTGGAGTCGTTTGCCGACCTGGGCAAG
CCGCGTGACCTGGCCAAGGTGTTCGATACGGTCGAATACGCCAAGTGGAAGTCGTTCCGCGAGTCGGAGG
ATTCGCGCTACGTGGGCTTGACGATGCCGCGCTTCCTGGGCCGGCTGCCGTACAACCCCAAGGACGGCAC
CACCGTCGAGGGCTTCAACTTCGTCGAAGACGTGGACGGCACCGACCACAGCAAATACCTGTGGTGCAAC
GCGGCCTGGGCGTTCGGCGCGCGGCTGACCGCCGCATTCGAAGACTTCGGCTGGTGCGCGGCGATCCGCG
GCGTGGAAGGCGGCGGGCTGGTCGAAGACCTGCCGACGCATACCTTCAAGACCGACGACGGCGAAATCGC
GCTCAAGTGCCCGACGGAAATCGCCATCACCGATCGCCGCGAGAAGGAACTGAGCGACCTGGGCTTCATC
CCGCTCGTGCACTGCAAGAACTCGGACTACGCTGCGTTCTTCGCCGCGCAGTCGGTGCAGCGGCCCAAGA
AGTACGACACCGACAGCGCGAATGCCAACGCGGTGCTGTCGGCGCAGCTGCAGTACATCTTCTCGGTATC
GCGCGTGGCGCACTACCTGAAGGCAATGATGCGCGACAAGATCGGCAGCTTTGCGTCGGCCAAGAATGTC
GAGACCTTCCTCAACCGGTGGATTTCGCAGTATGTCCTGCTGGACGACAACGCGACCCAGGAGCAGAAGG
CGCAGTTCCCGCTGCGCGAGGCTTCGATCCAGGTGTCCGAAGTGCCCGGCAAGCCCGGTACGTACCGCTC
GGTGGCGTTCCTGCGGCCGCACTTCCAGCTCGATGAACTGTCGATCTCGCTGCGGCTGGTGGCGGACCTG
CCGAAGCCAACCAATTCCTGA
 Primer design