SecReT6
Protein ID: 17548966
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0745
Locus tagRS01963
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]935144..935647 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ8XRT6
KEGG IDrso:RS01963
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.50E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|17548966|ref|NP_522306.1| RSp0745 gene product [Ralstonia solanacearum GMI1000]
MKDIYVKFDSPAIKGESQDKDHKEWIEVNSWSQSIIQPRSATASTAGGHTAERCEHRDMVFSKDLDVVSP
LLYQHASGGTTFGEVTIEFFRADGEGNRVKYLEVKLKNAILSEVDSQVAAEGIPTDTFSLRYAAVQWKYT
QQKSAGGQGGNSQGAWSLTKNDKTYSV
 
Nucleotide Sequence: 504 bp     [Download]
>gi|17548221|ref|NC_003296.1|:935144-935647 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGAAGGATATCTACGTCAAGTTCGACAGCCCGGCCATCAAGGGGGAGTCCCAGGACAAGGATCACAAGG
AGTGGATCGAAGTCAACAGCTGGTCCCAGTCGATCATCCAGCCGCGTTCGGCCACGGCCTCGACCGCGGG
CGGCCATACCGCCGAGCGTTGCGAGCACCGCGACATGGTGTTCTCCAAGGACCTGGACGTGGTCAGCCCG
CTGCTGTACCAGCACGCTTCGGGCGGCACGACCTTCGGTGAAGTGACGATCGAGTTCTTCCGCGCCGACG
GTGAAGGCAACCGCGTGAAGTACCTCGAGGTCAAGCTGAAGAACGCGATTTTGAGCGAAGTGGATTCGCA
GGTGGCTGCCGAGGGCATCCCGACCGATACGTTCAGCCTGCGCTACGCGGCCGTGCAGTGGAAGTACACC
CAGCAGAAGAGCGCCGGCGGCCAGGGCGGCAACTCGCAGGGCGCCTGGAGCCTGACCAAGAACGACAAGA
CCTACTCGGTTTAA
 Primer design