SecReT6
Protein ID: 17548967
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0746
Locus tagRS01962
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]935708..936181 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ8XRT5
KEGG IDrso:RS01962
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.00E-19, Aligned region: 29..137
Protein Sequence: 157 a.a.     [Download]
>gi|17548967|ref|NP_522307.1| RSp0746 gene product [Ralstonia solanacearum GMI1000]
MKGFEPSLLDKLFDDEPHAPLPTALRQLSLEELKSTVARDIESLLNTRIVFEEDDLQSLPECKRSLLTYG
LNDFAGLSLASFYDRNYICQSLTKAIERHEPRLQHVSVSLEINERATNALCFGITAVLLVGPAREPVSFD
AMLQPSTLRYSVSRGRG
 
Nucleotide Sequence: 474 bp     [Download]
>gi|17548221|ref|NC_003296.1|:935708-936181 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGAAAGGTTTCGAACCCAGCCTGCTCGATAAGCTCTTCGACGACGAGCCGCATGCGCCCTTGCCGACGG
CTCTGCGGCAGCTTTCGCTGGAAGAGCTCAAGAGCACGGTGGCGCGCGATATCGAGTCCTTGCTCAATAC
GCGCATCGTCTTTGAAGAGGACGACCTGCAGAGCCTGCCCGAATGCAAGCGGTCGCTGCTGACCTACGGG
CTGAACGATTTCGCGGGCCTGAGCCTCGCCAGCTTCTACGACCGCAATTACATCTGCCAGTCGCTCACCA
AGGCGATCGAGCGGCACGAGCCGCGGCTGCAGCACGTCAGTGTCTCGCTTGAAATCAACGAGCGGGCGAC
CAACGCGCTGTGCTTCGGCATCACTGCGGTCTTGCTGGTCGGGCCGGCGCGCGAGCCCGTGAGCTTTGAT
GCGATGCTGCAGCCGTCCACGCTGCGGTATTCCGTCTCGCGCGGGCGCGGCTGA
 Primer design