SecReT6
Protein ID: 17548968
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0747
Locus tagRS01961
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]936244..938094 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ8XRT4
KEGG IDrso:RS01961
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-209, Aligned region: 4..615
Protein Sequence: 616 a.a.     [Download]
>gi|17548968|ref|NP_522308.1| RSp0747 gene product [Ralstonia solanacearum GMI1000]
MEELLPYYERELAFLRRYSRDFAERYPKIAGRLAMSGDGCDDPHVERMIESFALLSARVSKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSVVHFDVRGAAAQLSAPVQIPRGTFLTSRVVRKVECSFRTAYDVTFAPVRI
AAATYARAVSAPSAVSLPKGATGAIALTLEYVGERGGFESLPLDRLRVYMDGEPSFVAALGDALFLHTAG
TYVEGERPGVWTGLSGVPLHEVGFAEDEALIDCPARSHPAYRLLTEHFSFAEKFNFFDIDLAAVRRRLTP
GVPVRRLVLHLVLKDVRSDSHAARLLEGLQAEHLRLHCTPVVNLFQQNADPIRIEHTASAYPVVADSRRA
HGFDIYSIDKVHLVRETAAHEEVTEFRPFYSLHHGEEPGQAGHYWIARRNELVAQRSPGFETEISIVDTR
FDPASPQTDTLSLTVTCTNRDLPSTLAFGQPDGDLSMEGNSVARAIMLLRKPTPSMRLGGGRAAQWRLIS
MLSLNHLSLVQNGLPTLKEMLRLHDLPHSAISARQIEGVVGLDYAPATHWLAGKPFATFVRGLEIRLTLD
EDAFVGTGLHRFIRVLDHFFGLYVHINSFVQLIAVSRRSGKELVRCAPRSGESILV
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|17548221|ref|NC_003296.1|:936244-938094 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGGAAGAGCTGCTGCCCTATTACGAACGAGAACTGGCCTTCCTGCGCCGGTACTCGCGCGATTTCGCCG
AGCGTTATCCGAAGATCGCTGGCCGGCTCGCCATGTCGGGCGACGGCTGCGACGATCCGCACGTCGAGCG
GATGATCGAGTCGTTCGCGCTGCTGAGCGCCCGCGTCAGCAAGAAGCTGGACGACGACTACCCCGAATTC
ACCGAGGCGCTGCTGGAGGTCCTGTACCCCCATTACCTGCGTCCGTTCCCGTCGTGCTCCGTGGTGCATT
TCGATGTGCGCGGCGCGGCGGCCCAGCTCAGCGCGCCGGTGCAGATTCCGCGTGGCACCTTCCTGACCTC
GCGCGTGGTGCGCAAGGTCGAGTGCAGTTTCCGCACCGCTTACGACGTCACCTTCGCGCCGGTGCGGATT
GCCGCGGCCACTTACGCGCGCGCCGTGTCCGCGCCGTCGGCGGTCAGTCTGCCCAAGGGGGCGACCGGTG
CGATCGCGCTGACCCTGGAATACGTTGGCGAGCGCGGCGGCTTCGAGTCCCTGCCGCTCGACCGGCTGCG
CGTCTACATGGACGGCGAGCCCTCGTTCGTGGCCGCGCTGGGGGATGCGCTGTTCCTGCATACCGCGGGA
ACCTACGTGGAGGGCGAGCGACCGGGCGTGTGGACCGGCTTGTCCGGTGTGCCCCTGCATGAGGTCGGCT
TCGCGGAAGACGAGGCGCTGATCGACTGCCCGGCGCGCTCGCATCCGGCCTATCGGTTGCTGACCGAGCA
CTTCAGTTTTGCCGAGAAATTCAATTTCTTCGACATCGACCTGGCAGCCGTGCGGCGCAGGCTGACGCCC
GGCGTGCCGGTTCGCCGCCTGGTGCTGCACCTGGTCCTGAAGGACGTGCGCAGCGACTCGCACGCTGCCC
GCCTGCTCGAAGGCTTGCAGGCCGAACACCTGCGCCTGCATTGCACGCCGGTGGTCAACCTGTTCCAGCA
GAATGCCGATCCGATCCGCATCGAGCACACCGCCAGCGCCTACCCGGTCGTGGCCGACAGCCGACGTGCG
CACGGCTTCGACATCTACTCGATCGACAAGGTGCACCTGGTGCGCGAGACCGCCGCGCACGAAGAGGTGA
CCGAGTTCCGCCCGTTCTACTCGCTGCACCACGGCGAGGAGCCCGGGCAAGCGGGCCACTACTGGATCGC
CCGGCGCAACGAGCTCGTGGCGCAGCGCAGCCCCGGCTTCGAGACTGAGATCTCCATCGTCGATACCCGG
TTCGATCCGGCCAGCCCGCAGACCGACACGCTGAGCCTGACCGTCACCTGCACCAACCGCGATCTGCCGT
CCACGCTGGCGTTCGGCCAGCCGGACGGCGACCTGTCGATGGAAGGCAATTCCGTCGCTCGCGCCATCAT
GTTGCTGCGCAAGCCGACGCCGTCGATGCGCCTGGGCGGCGGCCGCGCGGCGCAGTGGCGGCTGATTTCG
ATGCTCTCGCTCAACCACCTGTCGCTGGTGCAGAACGGGCTGCCGACGCTCAAGGAGATGCTGCGCCTGC
ATGATCTGCCGCATAGCGCCATTTCGGCGCGGCAGATCGAGGGCGTGGTCGGCCTCGACTACGCGCCGGC
CACGCACTGGCTGGCCGGCAAGCCGTTCGCCACGTTTGTGCGGGGGCTGGAGATCCGGCTCACGCTGGAC
GAAGACGCTTTCGTCGGCACGGGCCTGCATCGCTTCATCCGCGTGCTGGACCACTTCTTCGGCCTGTACG
TCCATATCAACAGCTTTGTGCAGCTGATTGCGGTATCGCGCCGCAGCGGCAAGGAACTGGTCAGATGCGC
ACCTCGCAGCGGCGAATCGATCCTGGTGTGA
 Primer design