SecReT6
Protein ID: 17548969
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0748
Locus tagRS01960
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]938058..939149 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ8XRT3
KEGG IDrso:RS01960
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.50E-91, Aligned region: 18..344
Protein Sequence: 363 a.a.     [Download]
>gi|17548969|ref|NP_522309.1| RSp0748 gene product [Ralstonia solanacearum GMI1000]
MRTSQRRIDPGVIRRLLRQPYRYEFFQAVRLLEQLFARRGNAVSEHALATRVSFRNTLSLSFPPSELQAI
EAARVTPDMLESDAAFIAALEDGVLDTVAITPTFFGMLGVQGALPLRYTEIVAEREAVWRDRAARAFFDI
FSNRATALFYLAWKKYRLPFQYEVDADRHYLPLLLSLAGAADATLRRDLSDTPGPVHDEALAGYATAIRH
RPVSAAYLRRVLADYFRAPMRVEQFVGNWYRVPPSQYSRLGGTNNVLGATALAGARVWQRDLRVRVWVGP
LARAQYRNFLPGAPGARALRKMLTILCGATLEFEIKLILRRQDVAGCTLGAQDSGRIGWDTFLCSHPAQH
DRSDAQYTLAPLH
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|17548221|ref|NC_003296.1|:938058-939149 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGCGCACCTCGCAGCGGCGAATCGATCCTGGTGTGATCCGCAGGCTGCTGCGGCAGCCGTACCGGTACG
AGTTCTTCCAGGCCGTGCGGCTGCTGGAGCAGCTGTTCGCGCGCCGGGGCAACGCCGTGTCCGAGCATGC
GCTGGCCACGCGCGTGAGTTTCCGCAACACGCTGTCGCTGTCGTTTCCGCCCAGCGAGCTGCAGGCCATC
GAGGCCGCTCGCGTGACGCCCGACATGCTGGAGAGCGATGCGGCCTTCATCGCGGCGCTCGAGGACGGCG
TGCTCGATACCGTGGCCATCACGCCGACCTTCTTCGGCATGCTGGGCGTTCAGGGGGCGCTGCCGCTGCG
CTACACCGAGATCGTCGCCGAGCGTGAGGCCGTGTGGCGCGACCGTGCCGCGCGGGCCTTCTTCGACATC
TTCTCGAACCGCGCGACGGCGCTGTTCTACCTGGCCTGGAAGAAGTACCGCCTGCCGTTCCAGTACGAGG
TCGACGCCGACCGGCATTACCTGCCGCTGTTGCTGTCGCTGGCCGGCGCCGCAGACGCGACGCTGCGCCG
CGATCTGTCCGACACGCCGGGGCCGGTCCATGACGAGGCGCTGGCCGGCTATGCCACGGCGATCCGGCAT
CGGCCCGTGTCGGCGGCGTACCTGCGGCGCGTGCTGGCGGACTACTTCCGGGCGCCGATGCGCGTCGAAC
AGTTCGTCGGCAACTGGTATCGCGTGCCGCCGTCGCAGTATTCGCGGTTGGGCGGCACCAACAACGTGCT
GGGCGCCACCGCGCTGGCCGGTGCCCGCGTCTGGCAGCGCGACCTGCGGGTGCGCGTGTGGGTCGGCCCG
CTGGCGCGCGCGCAGTACCGCAACTTCCTGCCGGGCGCGCCCGGCGCGCGGGCACTGCGCAAGATGCTGA
CGATCCTGTGCGGCGCCACGCTCGAATTCGAAATCAAGCTGATCCTGCGGCGTCAGGACGTGGCCGGCTG
CACGCTGGGCGCGCAGGACAGCGGCCGGATCGGTTGGGACACCTTCCTGTGCTCGCATCCGGCGCAGCAC
GACCGCAGCGACGCGCAATACACCCTCGCACCGCTGCATTGA
 Primer design