SecReT6
Protein ID: 17548970
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0749
Locus tagRS01959
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]939182..941899 [+]
ProductCLPA/B-type chaperone protein
NoteTssH
UniProt IDQ8XRT2
KEGG IDrso:RS01959
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.60E-43, Aligned region: 232..311
AAA_2 [PF07724], Evalue: 3.60E-43, Aligned region: 635..802
AAA [PF00004], Evalue: 2.20E-19, Aligned region: 232..344
AAA [PF00004], Evalue: 2.20E-19, Aligned region: 640..758
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 640..758
ClpB_D2-small [PF10431], Evalue: 3.00E-12, Aligned region: 386..403
ClpB_D2-small [PF10431], Evalue: 3.00E-12, Aligned region: 811..886
Clp_N [PF02861], Evalue: 1.20E-10, Aligned region: 23..75
Clp_N [PF02861], Evalue: 1.20E-10, Aligned region: 114..128
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 209..254
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 614..678
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 706..728
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 805..841
AAA_22 [PF13401], Evalue: 3.40E-07, Aligned region: 231..318
AAA_22 [PF13401], Evalue: 3.40E-07, Aligned region: 636..660
AAA_22 [PF13401], Evalue: 3.40E-07, Aligned region: 701..733
Sigma54_activat [PF00158], Evalue: 4.00E-06, Aligned region: 211..248
Sigma54_activat [PF00158], Evalue: 4.00E-06, Aligned region: 637..740
AAA_25 [PF13481], Evalue: 6.60E-06, Aligned region: 227..255
AAA_25 [PF13481], Evalue: 6.60E-06, Aligned region: 287..328
AAA_25 [PF13481], Evalue: 6.60E-06, Aligned region: 634..657
Arch_ATPase [PF01637], Evalue: 2.50E-05, Aligned region: 211..246
Arch_ATPase [PF01637], Evalue: 2.50E-05, Aligned region: 284..369
Arch_ATPase [PF01637], Evalue: 2.50E-05, Aligned region: 636..676
Arch_ATPase [PF01637], Evalue: 2.50E-05, Aligned region: 710..733
AAA_29 [PF13555], Evalue: 7.40E-05, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 7.40E-05, Aligned region: 635..664
AAA_29 [PF13555], Evalue: 7.40E-05, Aligned region: 732..766
AAA_17 [PF13207], Evalue: 0.00011, Aligned region: 232..295
AAA_17 [PF13207], Evalue: 0.00011, Aligned region: 639..675
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 224..255
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 639..657
AAA_18 [PF13238], Evalue: 0.0016, Aligned region: 232..252
AAA_18 [PF13238], Evalue: 0.0016, Aligned region: 641..664
AAA_19 [PF13245], Evalue: 0.0018, Aligned region: 232..258
AAA_19 [PF13245], Evalue: 0.0018, Aligned region: 525..541
AAA_19 [PF13245], Evalue: 0.0018, Aligned region: 635..661
NACHT [PF05729], Evalue: 0.0019, Aligned region: 232..259
NACHT [PF05729], Evalue: 0.0019, Aligned region: 427..462
NACHT [PF05729], Evalue: 0.0019, Aligned region: 640..660
T2SE [PF00437], Evalue: 0.002, Aligned region: 215..249
T2SE [PF00437], Evalue: 0.002, Aligned region: 623..676
Zeta_toxin [PF06414], Evalue: 0.0024, Aligned region: 232..252
Zeta_toxin [PF06414], Evalue: 0.0024, Aligned region: 631..679
ResIII [PF04851], Evalue: 0.0047, Aligned region: 218..251
ResIII [PF04851], Evalue: 0.0047, Aligned region: 300..314
ResIII [PF04851], Evalue: 0.0047, Aligned region: 443..512
ResIII [PF04851], Evalue: 0.0047, Aligned region: 611..660
AAA_23 [PF13476], Evalue: 0.0061, Aligned region: 232..249
AAA_23 [PF13476], Evalue: 0.0061, Aligned region: 442..492
AAA_23 [PF13476], Evalue: 0.0061, Aligned region: 636..666
Protein Sequence: 905 a.a.     [Download]
>gi|17548970|ref|NP_522310.1| RSp0749 gene product [Ralstonia solanacearum GMI1000]
MATPLKTLIAKLNATSRQAAERAASLCMARGNYEVDLEHLFLALLENRRSDFAVAARASGIDPAALQRDL
EAEVGRFQTGNTRTPAFSPYLPKLFEHAWLIASLDSQITRIRSGHLLLALLTEPSLAALAERGSRLFGRF
EVERLKHDFERMTTGSDEQEQAVDFADGTAVQTDDGRTAPAAALGATPALDQFTVDLTQAAREGRIDPVI
GRDAEIRQVVDILMRRRQNNPILTGEAGVGKTAVVEGLALRVAANDVPPPLRGVTLRTLDMGLLQAGASV
KGEFENRLKNVIDEVKKSPKPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKVDEPSEPLAAAMLRGMAPLMERHFGVRVLDEAITEAVRLSHRYISGRQLPDKAV
SVLDTACAKVALGQSATPGAIEDDQKLLERLLGEIAALQREQSAGAAHDARLEALQAKRAELEQRIAQNT
ERLARERALVARIQALREARESDAAQAGAQDAEPVAANSDVVALSPKRARAADAPDELATLLAELRALQG
EAPMVPLQVDGHVVSEIVSAWTGIPLGRMVKDELRTVLNLKPLLAARVIGQDHALDAIAQRVRTASANLE
DPNKPRGVFLFAGPSGVGKTETALALADILYGGERKLITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVL
TEAVRRNPYSVVLLDEVEKAHPDVLEMFFQVFDKGEMDDAEGRPIDFRNTIIILTSNVGSSAIMQACLNQ
PAEALPDADTLAETLRPVLYKAFKPAFLGRTKVVPYYPIADDVLAEIITLKLGRIRDRVAANHKATFQWD
NALVESVLARCTEVDAGARAVDHILNGTLLPEIAEAVLTRMAEGGSVEKIKVSVGKTGEFKYRIN
 
Nucleotide Sequence: 2718 bp     [Download]
>gi|17548221|ref|NC_003296.1|:939182-941899 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGGCCACCCCACTCAAGACCTTGATCGCCAAGCTGAACGCGACCAGCCGGCAGGCCGCCGAGCGCGCGG
CGTCGCTGTGCATGGCGCGCGGCAACTATGAAGTCGACCTGGAGCACCTGTTCCTGGCGCTGCTCGAAAA
CCGCCGCAGCGATTTCGCTGTCGCGGCGCGCGCCAGCGGCATCGATCCGGCCGCGCTGCAGCGCGACCTG
GAGGCCGAGGTGGGGCGCTTCCAGACCGGCAACACGCGCACGCCGGCGTTCTCGCCGTATCTGCCCAAGC
TGTTCGAGCATGCGTGGCTGATCGCCTCGCTGGATTCGCAGATCACGCGCATCCGCTCGGGCCACCTGCT
GCTCGCGCTGCTGACCGAGCCCAGCCTGGCCGCGCTGGCCGAACGCGGCTCGCGGCTGTTCGGCCGCTTC
GAGGTGGAGCGGCTCAAGCACGATTTCGAGCGCATGACCACCGGCTCCGACGAGCAGGAGCAGGCCGTCG
ATTTCGCCGACGGCACGGCCGTGCAGACGGACGATGGCCGCACCGCGCCCGCCGCCGCGCTGGGCGCGAC
ACCGGCCCTCGACCAGTTCACCGTGGACCTGACGCAGGCCGCCCGCGAAGGCCGCATCGATCCGGTGATC
GGGCGCGACGCCGAGATCCGCCAGGTGGTCGACATCCTGATGCGCCGGCGCCAGAACAACCCCATCCTGA
CCGGCGAGGCCGGTGTCGGCAAGACGGCGGTGGTGGAGGGGCTTGCGCTGCGCGTGGCCGCCAACGACGT
GCCGCCGCCGCTGCGGGGCGTGACGCTGCGCACGCTCGACATGGGCCTGCTGCAGGCCGGCGCGAGTGTG
AAGGGCGAGTTCGAGAACCGCCTGAAGAACGTGATCGACGAGGTCAAGAAGAGCCCGAAGCCGATCATTC
TGTTCATCGACGAGGCGCACACCATCATCGGCGCGGGCGGGCAGGCCGGGCAGAACGATGCGGCCAATCT
GCTCAAGCCGGCACTGGCGCGCGGTGAGCTGCGCACCATCGCCGCGACCACCTGGAGCGAGTACAAGAAG
TATTTCGAAAAGGACGCCGCCCTCGCGCGCCGCTTCCAGGTCGTCAAGGTCGACGAGCCGAGCGAGCCGC
TGGCCGCGGCCATGCTGCGCGGCATGGCGCCGCTGATGGAGCGCCACTTCGGCGTGCGCGTGCTGGACGA
GGCTATCACCGAGGCCGTGCGCCTGTCGCATCGCTACATCAGCGGGCGGCAGCTGCCGGACAAGGCGGTC
AGCGTGCTGGACACGGCGTGCGCCAAGGTGGCACTGGGCCAGAGCGCCACGCCGGGCGCCATCGAAGACG
ACCAGAAATTGCTGGAGCGTCTGCTGGGCGAGATCGCCGCGCTGCAGCGCGAGCAGAGCGCCGGCGCGGC
GCACGATGCCCGCCTCGAAGCGCTGCAGGCCAAGCGCGCCGAGCTGGAGCAGCGCATCGCGCAGAACACC
GAGCGCCTGGCCCGGGAGCGTGCGCTGGTCGCGCGCATCCAGGCGCTGCGCGAGGCGCGCGAAAGCGACG
CGGCGCAGGCCGGCGCGCAGGACGCGGAGCCGGTGGCGGCCAACAGCGATGTGGTGGCGCTGTCGCCCAA
GCGCGCCCGTGCCGCCGACGCGCCGGACGAACTGGCCACGCTGCTGGCCGAGCTGCGCGCGCTGCAGGGC
GAGGCGCCCATGGTGCCGCTGCAGGTGGACGGCCATGTCGTGTCGGAGATCGTCTCGGCCTGGACGGGCA
TTCCGCTGGGCCGCATGGTCAAGGACGAACTGCGCACCGTGCTGAACCTGAAGCCGCTGCTGGCCGCGCG
CGTGATCGGCCAGGACCACGCGCTGGACGCCATCGCCCAGCGCGTGCGCACCGCCTCGGCCAACCTGGAA
GACCCGAACAAGCCGCGCGGCGTGTTCCTGTTCGCGGGCCCGTCGGGCGTGGGCAAGACCGAGACGGCGC
TGGCGCTGGCCGACATCCTCTACGGCGGCGAGCGCAAGCTCATCACCATCAACATGAGCGAGTACCAGGA
GGCGCACAGCGTCTCGGGCCTGAAGGGCTCGCCGCCGGGTTACGTGGGCTACGGCGAGGGCGGTGTGCTG
ACCGAGGCGGTGCGCCGCAACCCGTACAGCGTGGTGCTGCTGGACGAAGTCGAGAAAGCCCACCCCGACG
TGCTGGAGATGTTCTTCCAGGTGTTCGACAAGGGCGAGATGGACGACGCCGAGGGCCGCCCCATCGACTT
CCGCAACACCATCATCATCCTGACCTCGAACGTGGGCTCGTCGGCCATCATGCAGGCCTGCCTGAACCAG
CCCGCCGAGGCGCTGCCCGACGCCGATACCCTGGCCGAGACGCTGCGGCCGGTGCTGTACAAGGCCTTCA
AGCCGGCCTTCCTGGGGCGGACCAAGGTGGTGCCGTACTACCCGATCGCCGACGACGTGCTGGCCGAGAT
CATCACGCTCAAGCTCGGCCGCATCCGCGACCGCGTGGCCGCCAACCACAAGGCGACGTTCCAGTGGGAC
AACGCGCTGGTGGAATCCGTGCTGGCCCGCTGCACCGAAGTGGATGCGGGCGCGCGCGCGGTCGACCACA
TCCTCAACGGCACGCTGCTGCCCGAGATCGCCGAAGCGGTGCTCACGCGCATGGCCGAAGGCGGCAGCGT
CGAGAAGATCAAGGTCAGTGTCGGCAAGACCGGCGAGTTCAAATACCGCATCAACTGA
 Primer design