SecReT6
Protein ID: 17548971
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0750
Locus tagRS01958
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]941920..944676 [+]
ProductVGR-related protein
NoteTssI
UniProt IDQ8XRT1
KEGG IDrso:RS01958
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-69, Aligned region: 42..362
DUF2345 [PF10106], Evalue: 8.20E-40, Aligned region: 542..583
DUF2345 [PF10106], Evalue: 8.20E-40, Aligned region: 625..680
DUF2345 [PF10106], Evalue: 8.20E-40, Aligned region: 724..885
T6SS_Vgr [PF13296], Evalue: 3.10E-25, Aligned region: 585..689
T6SS_Vgr [PF13296], Evalue: 3.10E-25, Aligned region: 772..780
Phage_base_V [PF04717], Evalue: 3.70E-19, Aligned region: 430..532
Protein Sequence: 918 a.a.     [Download]
>gi|17548971|ref|NP_522311.1| RSp0750 gene product [Ralstonia solanacearum GMI1000]
MVSPTELANLLRAAFTQANRLLRLDTPLGPNALLPERLDVAEHLDDGGFRLELTALSDDADLDPARLLGQ
PVRLDLLTQQSRGALRPFHGHVTRFEQLGANGGLVRYRLVIEPWLAFLRHRRDSFLFQDQSVIEVIDSLF
GDYNGQGRLAPAWRWSLRDASVYTRRSVITQYEESDFDFVTRLLAEEGLFYFFEHEAVEGDALGVHRMVI
ADANDVFTDNAQAAIRFGRADATANEDVIDRWQGVRRWQTNAVSIASWDYRANTQRSAQLGAQQWRDGIP
QLTLQDTDYPGQYWFEDSAQAQRSARLVMEALELRDKQFDGEGSVRTLALGTRFQLVDHYEHGDDGEARF
AVLSVLHRARNNFNERFGQVLTQALGALSGADAQDAAGNAGTDATFYRNHFTVVHDTVPYRPQQRDAQGR
ALHPRPTVEGSQTALVVGTGGPVHTDRDHRIKVQFHWQRGARSASRQPHPAGDDNARAEAGLGCWVRVAA
PVAGPNWGGVALPRVGQEVLVEFVQGDIDRPVVVGAAYNGSGQRDAQYNQNQAGAAGATGNAPAWFAGDS
KSQGAYAHNAVLSGIKTQALAGSQTGASGYSQLVFDDTEGQGRTQLSTTQAATALTLGHQKEQIDSARQA
DLGHGAALATNDSGSVRAGAGLLLTAHAADTGAALLDSEGAASQIEALSELAESLADVARKQQAGLPEEP
AAQDLPALKQLRHTTEVLRHAESAGKGASAIAYSEPHLQVSAPKGIAATTPADAVLVAGTQIALAAKQDA
NLAAGGNLAMAVADGLTLFAHGKAVGQSSDAARGIAMHAASGKVSLSALKGESRLVAEKAVTVASTQGNV
TAEGKARVLVNAAGAQIRVTNGTIELHAPGKTIFKGAGHVFVGPGGGAVSNTLAQGNLKGCGTQEGNAAT
KGTGSISR
 
Nucleotide Sequence: 2757 bp     [Download]
>gi|17548221|ref|NC_003296.1|:941920-944676 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGGTCTCACCGACCGAGCTGGCCAACCTGCTGCGGGCCGCCTTCACGCAGGCCAATCGGCTGCTGCGCC
TGGATACGCCGCTCGGGCCGAACGCGCTGCTGCCCGAGCGGTTGGACGTCGCCGAGCATCTCGACGATGG
CGGCTTCCGGCTGGAGCTGACCGCGCTGTCGGATGACGCCGATCTCGATCCGGCGCGCCTGCTGGGGCAG
CCCGTCCGGCTCGACCTGCTGACCCAGCAGAGCCGCGGCGCGCTGCGGCCGTTCCATGGCCACGTCACGC
GGTTCGAGCAGTTGGGCGCCAACGGCGGCCTGGTGCGCTACCGGCTGGTGATCGAACCCTGGCTGGCCTT
CCTGCGCCACCGGCGCGACAGCTTCCTGTTCCAGGACCAGTCGGTGATCGAAGTGATCGACAGCCTGTTC
GGCGACTACAACGGCCAGGGCCGCCTGGCGCCGGCGTGGCGCTGGTCGCTGCGCGATGCCTCGGTGTACA
CGCGCCGCAGCGTCATCACGCAATACGAAGAAAGCGATTTCGACTTCGTCACCCGCCTGCTGGCCGAGGA
AGGGCTGTTCTACTTCTTCGAGCACGAGGCGGTCGAGGGCGATGCGCTGGGCGTGCACCGCATGGTGATC
GCCGATGCCAACGATGTCTTCACCGACAACGCGCAGGCCGCGATCCGCTTCGGCCGCGCCGATGCCACCG
CCAATGAAGACGTGATCGACCGCTGGCAGGGCGTGCGGCGCTGGCAGACCAACGCCGTGTCGATCGCCAG
TTGGGACTACCGCGCCAACACCCAGCGCAGCGCCCAGCTCGGCGCGCAGCAGTGGCGCGACGGCATCCCG
CAACTGACGCTGCAGGACACCGACTACCCCGGCCAGTACTGGTTCGAAGACAGCGCCCAGGCCCAGCGCA
GCGCGCGCCTGGTGATGGAAGCGCTGGAGCTGCGCGACAAGCAGTTCGACGGCGAAGGCAGCGTGCGCAC
GCTGGCGCTGGGCACGCGCTTCCAACTGGTTGATCATTATGAGCACGGCGACGACGGCGAGGCGCGCTTC
GCCGTGCTGTCCGTCCTGCACCGGGCACGCAACAACTTCAACGAGCGCTTTGGCCAGGTGCTGACGCAGG
CGCTGGGCGCGCTGTCCGGCGCCGACGCGCAAGACGCCGCGGGCAACGCGGGCACCGACGCCACGTTTTA
CCGTAACCACTTCACGGTCGTGCACGATACCGTGCCGTACCGCCCGCAGCAGCGCGATGCGCAGGGCCGT
GCGCTGCATCCGCGTCCGACGGTCGAGGGCAGCCAGACCGCACTGGTGGTGGGCACCGGTGGCCCGGTGC
ATACGGACCGCGATCATCGCATCAAGGTCCAGTTCCATTGGCAGCGCGGCGCACGCTCGGCCAGTCGGCA
GCCGCATCCGGCCGGCGATGACAACGCCCGCGCGGAGGCCGGCCTGGGCTGCTGGGTGCGCGTGGCGGCG
CCGGTGGCCGGGCCCAACTGGGGCGGCGTGGCGTTGCCGCGCGTGGGCCAGGAAGTGCTGGTGGAATTCG
TGCAGGGCGATATCGACCGGCCGGTGGTGGTGGGCGCGGCCTATAACGGCAGCGGCCAGCGCGACGCGCA
GTACAACCAGAACCAGGCCGGCGCGGCGGGCGCGACCGGCAACGCGCCGGCCTGGTTTGCCGGCGACAGC
AAGAGCCAGGGGGCGTACGCGCACAACGCGGTGCTCTCCGGCATCAAGACGCAGGCGCTGGCCGGCAGCC
AGACGGGCGCCTCGGGTTACAGCCAGCTCGTGTTCGACGATACCGAGGGCCAGGGCCGCACGCAGCTGAG
CACCACCCAGGCCGCCACCGCGCTCACGCTGGGGCACCAGAAGGAACAGATCGACAGCGCCCGCCAGGCC
GACCTAGGACACGGCGCGGCGCTGGCCACCAACGACAGCGGCAGCGTGCGCGCCGGCGCGGGCCTGCTGC
TCACCGCGCACGCCGCCGACACCGGCGCCGCGCTTCTCGACAGCGAAGGCGCCGCCAGCCAGATCGAAGC
CCTCAGCGAACTGGCCGAATCGCTGGCCGACGTGGCCCGGAAGCAGCAGGCCGGCCTGCCGGAAGAGCCT
GCCGCGCAAGACCTGCCCGCGCTCAAGCAACTGCGGCACACCACCGAAGTGCTGCGCCACGCGGAAAGCG
CAGGCAAAGGCGCCTCGGCCATCGCCTACAGCGAACCGCATCTGCAAGTCAGCGCGCCGAAGGGGATTGC
CGCGACCACGCCGGCCGACGCCGTGCTGGTGGCCGGCACCCAGATCGCATTGGCGGCCAAGCAGGACGCC
AACCTCGCGGCGGGCGGCAACCTGGCAATGGCCGTGGCCGACGGCCTGACCCTGTTCGCGCACGGCAAGG
CGGTGGGCCAGTCATCCGACGCGGCCCGGGGCATCGCGATGCATGCGGCGAGCGGCAAGGTGAGCTTGAG
CGCCCTGAAGGGCGAGAGCCGGCTGGTGGCCGAGAAAGCCGTCACGGTGGCATCCACGCAGGGCAATGTC
ACGGCGGAGGGCAAGGCGCGCGTGCTGGTGAATGCGGCGGGCGCGCAGATCCGGGTGACCAACGGGACGA
TTGAGCTGCATGCGCCGGGGAAGACGATCTTCAAGGGGGCGGGGCATGTGTTTGTGGGGCCGGGTGGGGG
GGCGGTGAGCAATACGCTGGCCCAGGGCAATCTGAAGGGTTGCGGCACCCAGGAAGGTAATGCCGCAACG
AAAGGCACAGGGTCGATTTCGCGCTGA
 Primer design