SecReT6
Protein ID: 17548980
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0759
Locus tagRS01949
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]957153..958166 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ8XRS2
KEGG IDrso:RS01949
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-26, Aligned region: 34..95
ImpA-rel_N [PF06812], Evalue: 1.20E-26, Aligned region: 209..227
Protein Sequence: 337 a.a.     [Download]
>gi|17548980|ref|NP_522320.1| RSp0759 gene product [Ralstonia solanacearum GMI1000]
MLFSTEFDTIQEARRFDDPSLDQGDWVTEIKEADWRAVVSESTALLQKRTKDLRLAAWLTEALSKERGFA
GLREGYELIAGLCEQYWEHLFPLPEPDDPEARTGSMAWLAGRSSQLIREVPLVEAGNGGFNYVDWEVATN
LIEAIRRDPDQADELSRGKVTQDQFEAARRASSSAFYTALYNDVVGCGAALLRLESVLDGRAGDHAPSFR
AAREALQAVRALVERFGGKTETKPSAVEPKATTAPQQTAQPVAEAVPDTVVGPIRTRAQALNQLREVAEF
FRQTEPHSPVAYLAARAAKWGDMPLHAWLRAVVKDDATLSQIEELLGLGDSPADDAS
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|17548221|ref|NC_003296.1|:957153-958166 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGCTCTTCTCCACCGAATTCGACACCATCCAGGAAGCGCGGCGCTTCGACGACCCCTCGCTCGATCAGG
GCGACTGGGTGACCGAGATCAAGGAGGCGGACTGGCGCGCCGTCGTCTCGGAAAGCACGGCGTTGCTGCA
GAAGCGCACCAAGGACCTGCGCCTGGCCGCGTGGCTGACCGAGGCGCTGTCCAAGGAGCGCGGCTTCGCC
GGCCTGCGCGAGGGCTACGAGCTGATCGCGGGGCTGTGCGAGCAGTATTGGGAGCACCTCTTCCCGCTGC
CCGAGCCGGATGATCCCGAGGCGCGCACCGGCAGCATGGCGTGGCTGGCGGGGCGCTCCAGCCAGCTGAT
CCGCGAGGTGCCGCTGGTGGAGGCGGGCAACGGCGGCTTCAACTATGTCGACTGGGAGGTCGCCACCAAC
CTGATCGAGGCGATCCGGCGCGATCCGGACCAGGCGGATGAGCTGTCGCGCGGCAAGGTCACGCAGGATC
AGTTCGAGGCGGCGCGCCGCGCGTCGTCTTCGGCGTTCTACACGGCGCTGTACAACGACGTGGTGGGTTG
CGGCGCGGCGCTGCTGCGGCTGGAATCCGTGCTGGACGGGCGCGCCGGGGATCATGCGCCGAGCTTCCGC
GCCGCGCGCGAGGCCTTGCAGGCAGTCCGCGCCCTGGTCGAGCGTTTCGGCGGCAAGACGGAAACCAAGC
CCAGCGCGGTCGAGCCCAAGGCCACCACCGCGCCGCAGCAGACCGCCCAGCCCGTCGCCGAGGCCGTGCC
CGATACCGTGGTCGGCCCGATCCGCACGCGCGCCCAGGCGCTGAACCAGTTGCGCGAAGTGGCTGAGTTC
TTCCGCCAGACCGAGCCTCACAGCCCGGTGGCCTATCTCGCCGCACGCGCGGCCAAGTGGGGCGATATGC
CGCTGCACGCCTGGCTGCGCGCGGTGGTCAAGGACGATGCGACGCTGTCGCAGATCGAAGAACTGCTGGG
GTTGGGCGATTCGCCGGCGGATGACGCGAGCTGA
 Primer design