SecReT6
Protein ID: 17548982
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0761
Locus tagRS01947
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]959306..960139 [-]
Productlipoprotein
NoteTagL
UniProt IDQ8XRS0, Q8XRS0
KEGG IDrso:RS01947
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 8.50E-24, Aligned region: 115..144
OmpA [PF00691], Evalue: 8.50E-24, Aligned region: 175..269
BON [PF04972], Evalue: 0.0033, Aligned region: 50..85
BON [PF04972], Evalue: 0.0033, Aligned region: 118..156
Protein Sequence: 277 a.a.     [Download]
>gi|17548982|ref|NP_522322.1| RSp0761 gene product [Ralstonia solanacearum GMI1000]
MGLDAIRYGFRPATVLAAALAAACLGTLPAHAAPGDPAPASATSPVPGPVVAGGMVPDEATKASVLARLR
ELYGSANVVDQIEVGNVVSPPNWTGNVQKILSPQIKQVSRGQLNIDGTQVAVHGDVQNEAQRQQLASDMA
TTLGASYTIKNGLRVAAVSEQSLLDQTLANRIIEFETGSATLTPKGRGILDEMAAVLPRLNGRKIEIVGH
TDNSGSRAMNLNLSQARAETVKNYLISKGAEPGTLTAIGVGPDQPVAPNATDEGRSRNRRIEFRASQ
 
Nucleotide Sequence: 834 bp     [Download]
>gi|17548221|ref|NC_003296.1|:c960139-959306 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGGGTCTGGATGCAATCAGGTACGGCTTCCGGCCTGCAACGGTACTGGCGGCGGCCCTCGCGGCGGCTT
GCCTGGGCACCCTGCCCGCTCACGCCGCGCCGGGCGACCCGGCCCCCGCGTCCGCAACCAGCCCCGTGCC
GGGGCCGGTCGTGGCCGGCGGCATGGTTCCGGACGAGGCCACCAAGGCGAGCGTGCTGGCCAGGCTGCGC
GAGCTCTACGGCAGTGCCAACGTGGTCGACCAGATCGAGGTCGGCAACGTGGTGTCGCCGCCCAACTGGA
CGGGCAACGTGCAGAAGATCCTGTCGCCGCAGATCAAGCAGGTCAGCCGCGGCCAGCTCAACATCGACGG
CACGCAGGTGGCCGTGCACGGCGACGTGCAAAACGAAGCACAGCGCCAGCAGCTCGCCAGCGACATGGCC
ACCACGCTCGGCGCCAGCTACACGATCAAGAACGGACTGCGCGTGGCCGCCGTCTCGGAACAGAGCCTGC
TGGACCAGACCCTGGCCAACCGCATCATCGAGTTCGAGACCGGCAGCGCCACGCTCACGCCCAAGGGCCG
CGGCATCCTGGATGAAATGGCCGCCGTGCTGCCGCGCCTGAACGGCCGCAAGATCGAGATCGTCGGCCAC
ACCGACAACTCGGGCAGCCGCGCCATGAACCTCAACCTGAGCCAGGCCCGCGCCGAGACGGTGAAGAACT
ACCTGATCAGCAAGGGCGCCGAACCCGGCACGCTCACCGCCATCGGCGTCGGGCCGGACCAGCCGGTGGC
ACCCAACGCCACCGACGAGGGGCGGTCGCGCAATCGGCGGATCGAGTTCCGGGCTAGCCAGTGA
 Primer design