SecReT6
Protein ID: 17548984
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0763
Locus tagRS01945
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]961125..965066 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ8XRR8
KEGG IDrso:RS01945
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.00E-72, Aligned region: 80..102
ImcF-related_N [PF14331], Evalue: 1.00E-72, Aligned region: 183..441
IcmF-related [PF06761], Evalue: 1.60E-52, Aligned region: 488..864
DUF1215 [PF06744], Evalue: 9.70E-28, Aligned region: 63..100
DUF1215 [PF06744], Evalue: 9.70E-28, Aligned region: 1000..1113
Protein Sequence: 1313 a.a.     [Download]
>gi|17548984|ref|NP_522324.1| RSp0763 gene product [Ralstonia solanacearum GMI1000]
MRRFLNFLTHSRTLSVLGVLALTIILLLIALTFEIGLVWAGIALGVLLALWLATALWKRWRARRASARLE
GMLEQAADKSAAPDKREEVEALRVRLAEAVKTIKRSKLGQLSGDAALYELPWYIVIGNPAAGKSTAVLNS
GLQFPFADKGGAVIQGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRREWLGFLDLLKRYRPKAPINGIV
VTVSVSELTQNRPEFAINLAKNLRQRVQELTERLEVFAPVYVMFTKADLITGFTEFFGDSEKQERDRVWG
ASLPFEPDAKPDVAALFDQRFDELCDGLKEISVAQISLHQKNKLSPGLLSFPLEFASIKPALRAFLVTLF
DENPFQYKPVFRGFYFTSALQEGATNSASAERIARRFGLSTDGAARSREVFSKNGFFLRDLFSKVIFSDR
QTVRQFASPAKTRLRIATFFGLVLALGLLLGGWTWSYMGNRTLTANVQADLDKIVKLQQNRVDLQARLEA
LDILQDRIEQLERFRGEHPLALSLGLYQGDALQHKLLDEYYNGLRQVMLKPVGGALETFLAEVNTHPEQL
APMVRPPETGAVIATSVTSATATIAASGAAAGAPASASPTATATAAAPAGKRFTDASPSNVEDGYNALKT
YLMLSDKRHVEVAHLTDQITRFWRGWLEDNRGNMPREQMIRSAERNLSFFLARVNDDNWPLLEGNLSLID
QTRENLRRVVRGMPARERAYAEIKARASTRYAPMTVARIVGETGGNVIAGSYAVPGTFTKEAWQGYVQPA
IREAASKELQTKDWVLNVAARDDLTLEGSPEQIQKTLVTMYKTEYAREWQRFMQGVAVQDFTSFEQAVAG
MNLLGDPTNSPIRKVLDTAYDQTSWDNPSMLNAGLKQAKSGVLGWFKQLFARQTPSQINVNVDVGGNTET
GSIPMGPVGKEFAGLARVAVMHDDKSLLRGYMDALSKVRTRFNLIKNQGDPGPGARQLMQQTLDGNGSEL
ADTLKYVDEQMLTGMTDSERQTLRPLLVRPLLQSYAVVIRPASVEINKVWNAQVYQPFSQTLAEKYPFAA
NAKIEASAAEIGQIFGPEGAIAKFANTTIGPLSVRRGDMLAARTWGDLGLAFVPEFTAGFTRWIAPLTGG
AAGGAGGAAAAAPQTVFQILPVPSQGTTEYTIEIDGQQLRYRNTPPQWANFVWPNPQGAPGARVTATTFD
GRTVELLNEPGRFGLERLIATANRKRRPDGAFDLTWARGDISVSVSLRIISSPQTAGTSGSDSPQGQGLR
GLRLPTSIADATASQNTATPPAPAGSRPASAAAATTQATARTLVTQEQGGTAQ
 
Nucleotide Sequence: 3942 bp     [Download]
>gi|17548221|ref|NC_003296.1|:c965066-961125 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGCGACGCTTCCTCAACTTCCTGACCCACTCACGCACGCTCTCGGTTCTGGGCGTGCTCGCGCTGACGA
TCATCCTGCTGCTGATCGCGCTGACCTTCGAGATTGGCCTGGTCTGGGCCGGCATCGCGCTCGGCGTGCT
GCTGGCGCTGTGGCTGGCGACGGCGCTCTGGAAACGCTGGCGCGCGCGCCGGGCGAGCGCCAGGCTCGAA
GGCATGCTGGAGCAGGCCGCCGACAAGAGCGCCGCGCCGGACAAGCGCGAGGAAGTCGAGGCGCTGCGCG
TGCGCCTGGCCGAGGCAGTCAAGACCATCAAGCGCTCCAAGCTCGGGCAGCTGTCGGGCGATGCGGCCCT
CTATGAGCTGCCCTGGTACATCGTGATCGGCAACCCGGCGGCCGGCAAGAGCACGGCGGTGCTGAACTCG
GGCCTGCAGTTTCCGTTCGCCGACAAGGGCGGCGCGGTGATCCAGGGCATCGGCGGCACGCGCAACTGCG
ACTGGTTCTTCACCACCGAAGGCATCCTGCTCGACACGGCCGGCCGCTACTCGGTGCACGAGGAAGACCG
CCGCGAATGGCTCGGCTTCCTCGACCTGCTCAAGCGCTACCGCCCCAAGGCGCCGATCAACGGCATCGTC
GTGACGGTGAGCGTGTCGGAGCTCACGCAGAACCGTCCCGAGTTCGCCATCAACCTCGCCAAGAACCTGC
GCCAGCGCGTGCAGGAGTTGACCGAGCGGCTGGAAGTGTTCGCCCCGGTCTACGTGATGTTCACCAAGGC
CGACCTGATCACCGGCTTCACGGAATTCTTCGGCGACAGCGAGAAGCAGGAGCGCGACCGCGTGTGGGGC
GCCTCCCTGCCCTTCGAGCCGGACGCCAAGCCCGACGTGGCAGCGCTGTTCGACCAGCGCTTCGATGAGC
TGTGCGACGGTCTGAAGGAGATCAGCGTGGCGCAGATCTCGCTGCACCAGAAGAACAAGCTGTCGCCGGG
GCTGCTGAGCTTTCCGCTGGAGTTCGCCTCGATCAAGCCGGCGCTGCGCGCCTTCCTGGTGACGCTGTTC
GACGAGAACCCCTTCCAGTACAAGCCGGTGTTCCGCGGCTTCTACTTCACCAGCGCGCTGCAGGAAGGCG
CCACCAACAGCGCCTCGGCCGAGCGCATCGCGCGCCGCTTCGGGCTCAGCACGGACGGCGCCGCGCGCAG
CCGCGAGGTGTTCTCCAAGAACGGCTTCTTCCTGCGCGACCTGTTCTCCAAGGTCATCTTCTCCGACCGC
CAGACCGTGCGGCAATTCGCCAGCCCGGCCAAGACGCGCCTGCGCATCGCCACCTTCTTCGGGCTGGTGC
TGGCGTTGGGCCTGCTGCTGGGCGGCTGGACGTGGTCGTACATGGGCAACCGCACGCTGACCGCCAACGT
GCAGGCCGACCTCGACAAGATCGTCAAGCTGCAGCAGAACCGCGTCGACCTGCAAGCCCGGCTGGAAGCG
CTGGACATCCTGCAGGACCGCATCGAGCAGCTCGAGCGCTTCCGCGGCGAGCATCCGCTGGCGCTGTCGC
TGGGGCTATACCAGGGCGACGCGCTGCAGCACAAGCTGCTCGACGAGTACTACAACGGCCTGCGCCAGGT
GATGCTCAAGCCGGTGGGCGGCGCGCTCGAGACCTTCCTGGCCGAGGTCAACACGCACCCCGAGCAGCTC
GCGCCGATGGTGCGTCCGCCCGAGACCGGCGCGGTGATCGCCACCTCCGTCACCTCGGCGACGGCCACCA
TCGCGGCTTCGGGCGCCGCCGCCGGTGCGCCGGCATCGGCATCGCCCACGGCCACCGCCACGGCCGCCGC
GCCGGCCGGCAAGCGCTTCACCGATGCCTCGCCCTCCAACGTGGAAGACGGCTACAACGCGCTCAAGACC
TACCTGATGCTGTCGGACAAGCGCCACGTGGAAGTCGCGCACCTGACCGACCAGATCACGCGCTTCTGGC
GCGGCTGGCTGGAAGACAACCGGGGCAACATGCCGCGCGAGCAGATGATCCGCTCGGCCGAGCGCAACCT
GTCGTTCTTCCTGGCCCGCGTGAATGACGACAACTGGCCGCTGCTGGAAGGCAACCTGTCGCTGATCGAC
CAGACCCGCGAGAACCTGCGCCGCGTGGTGCGCGGCATGCCGGCGCGCGAACGCGCCTACGCCGAGATCA
AGGCCCGCGCCTCGACCCGCTATGCGCCGATGACGGTCGCGCGCATCGTCGGCGAGACCGGCGGCAACGT
GATCGCCGGCAGCTACGCCGTGCCCGGCACCTTCACCAAGGAGGCATGGCAGGGCTACGTGCAGCCCGCC
ATCCGCGAGGCCGCCAGCAAGGAGCTGCAGACCAAGGACTGGGTGCTCAACGTGGCCGCCCGCGACGACC
TGACGCTCGAAGGCAGCCCCGAGCAGATCCAGAAGACCCTGGTCACGATGTACAAGACCGAGTACGCCCG
CGAGTGGCAACGCTTCATGCAGGGCGTGGCCGTGCAGGACTTCACCAGCTTCGAGCAGGCCGTGGCCGGC
ATGAACCTGCTGGGCGATCCGACCAACTCGCCGATCCGCAAGGTGCTCGACACCGCCTACGACCAGACCT
CGTGGGACAACCCGTCCATGCTCAACGCCGGCCTCAAGCAGGCCAAGTCGGGCGTGCTGGGCTGGTTCAA
GCAGCTCTTCGCGCGGCAGACGCCGTCGCAGATCAACGTCAACGTGGACGTGGGCGGCAACACCGAGACC
GGCAGCATCCCGATGGGGCCGGTGGGCAAGGAGTTCGCCGGGCTGGCGCGCGTGGCGGTGATGCACGACG
ACAAATCGCTGCTGCGCGGCTACATGGACGCGCTGTCCAAGGTCCGCACCCGCTTCAACCTCATCAAGAA
CCAGGGCGACCCCGGCCCCGGCGCGCGCCAGCTGATGCAGCAGACGCTGGACGGCAACGGCTCCGAGCTG
GCCGACACCCTCAAGTACGTCGATGAGCAGATGCTGACCGGCATGACCGACAGCGAACGTCAGACGCTGC
GCCCGCTGCTGGTGCGCCCGCTGCTGCAGTCGTATGCGGTGGTGATCCGGCCGGCCAGCGTGGAGATCAA
CAAGGTGTGGAACGCGCAGGTCTACCAGCCGTTCAGCCAGACGCTGGCCGAGAAGTATCCGTTTGCCGCC
AACGCCAAGATCGAGGCCAGCGCGGCCGAGATCGGCCAGATCTTCGGGCCGGAGGGCGCCATCGCCAAGT
TCGCCAACACGACCATCGGCCCGCTGTCGGTGCGCCGCGGCGACATGCTGGCGGCCCGCACCTGGGGTGA
CCTGGGCCTGGCCTTCGTGCCCGAGTTCACCGCCGGCTTCACGCGCTGGATCGCCCCGCTGACGGGCGGT
GCGGCGGGCGGCGCCGGTGGCGCGGCGGCCGCGGCGCCGCAGACGGTGTTCCAGATTCTGCCGGTGCCGT
CGCAGGGCACCACCGAATACACCATCGAGATCGACGGCCAGCAACTGCGCTACCGCAACACGCCGCCGCA
ATGGGCCAACTTCGTCTGGCCGAATCCGCAGGGCGCGCCGGGCGCGCGCGTGACGGCCACGACCTTCGAC
GGCCGCACCGTGGAGCTGCTCAACGAACCGGGCCGCTTCGGCCTGGAGCGCCTGATCGCCACCGCGAACC
GCAAGCGTCGCCCCGATGGCGCGTTCGACCTGACGTGGGCGCGCGGCGACATCAGCGTGTCGGTCAGCCT
GCGCATCATCAGCAGCCCGCAGACGGCCGGCACCTCGGGCTCCGACTCGCCGCAAGGCCAGGGCCTGCGC
GGCCTGCGCCTGCCGACCTCGATCGCGGACGCGACCGCCTCGCAGAACACCGCCACGCCGCCCGCGCCGG
CAGGCAGCCGCCCGGCCAGCGCGGCCGCCGCGACGACCCAGGCCACCGCCCGGACCCTCGTCACACAAGA
GCAAGGGGGGACGGCGCAATGA
 Primer design