SecReT6
Protein ID: 17548986
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0765
Locus tagRS01943
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]966602..966871 [-]
Producthypothetical protein
NotePAAR
UniProt IDQ8XRR6
KEGG IDrso:RS01943
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.00E-25, Aligned region: 8..82
DUF4150 [PF13665], Evalue: 0.0019, Aligned region: 19..40
DUF4150 [PF13665], Evalue: 0.0019, Aligned region: 45..74
Protein Sequence: 89 a.a.     [Download]
>gi|17548986|ref|NP_522326.1| RSp0765 gene product [Ralstonia solanacearum GMI1000]
MTRPFILLGDKTDHGGVVITASGNTTTGGKGIACVGDKVTCPQSGHGGTTVIVTGDPNVVIDGRQAARHG
DKTACGATLLASQGTTGSI
 
Nucleotide Sequence: 270 bp     [Download]
>gi|17548221|ref|NC_003296.1|:c966871-966602 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGACACGTCCCTTCATCCTGCTGGGCGACAAGACCGACCACGGCGGCGTGGTGATCACCGCCTCGGGCA
ACACGACCACCGGCGGCAAGGGCATCGCCTGCGTCGGCGACAAGGTCACGTGCCCGCAATCGGGTCACGG
CGGCACGACCGTCATCGTCACGGGCGATCCGAACGTCGTCATCGATGGCCGGCAGGCCGCGCGCCATGGC
GACAAGACGGCCTGCGGCGCCACCCTCCTGGCCAGCCAGGGCACCACCGGCAGCATCTGA
 Primer design