SecReT6
Protein ID: 17548989
SecReT6 ID26
T6SS typei4b
Gene symbolRSp0768
Locus tagRS01940
StrainRalstonia solanacearum GMI1000
Repliconplasmid pGMI1000MP [GenBank: NC_003296] [Browse all T6SS(s) in this replicon]
Location [Strand]968930..971950 [+]
ProductVGR-related protein
NoteTssI
UniProt IDQ8XRR3
KEGG IDrso:RS01940
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-56, Aligned region: 37..354
Phage_GPD [PF05954], Evalue: 1.80E-56, Aligned region: 727..771
DUF2345 [PF10106], Evalue: 8.40E-41, Aligned region: 768..929
T6SS_Vgr [PF13296], Evalue: 3.30E-34, Aligned region: 614..724
T6SS_Vgr [PF13296], Evalue: 3.30E-34, Aligned region: 887..909
T6SS_Vgr [PF13296], Evalue: 3.30E-34, Aligned region: 964..990
Phage_base_V [PF04717], Evalue: 4.40E-20, Aligned region: 450..549
Protein Sequence: 1006 a.a.     [Download]
>gi|17548989|ref|NP_522329.1| RSp0768 gene product [Ralstonia solanacearum GMI1000]
MDVTTLLQNLFAPAHRLYALEGEGPIAELAVEAWLGREALSELFEWRVVAASANARFALESFIGQRVTLV
TTLADGTQARRTGLIRQAEQLGADGSLARYRLTVVPWFWLATQQRHSQVFQNRPLADILEQVLSPYAPYA
AWRFAAGAEDRMAAFGTRSHIAQFRETDYRFVTRLLAEAGLGFTTVEDEQAPSGHALLIFADSPRLAEDT
ASAAEGGIRYHRAHSQEERDAIQALICHSRTAVGGVAVAAWDAQAKRAFRAHVPSRFCGIAGSPDAYLSI
SPSLAPDTANAQRIAEQVMESVEARARLFIGRGSVRTLRSGTRLKIVDCPHLPKDVDGPYPLLIDLVEHC
GINNLTADTQATLARKLGGLDAALTFDTPPSPPESGPGPFGFMAPHEVIERFTPTADLLTAARAHGYAGQ
FRAGDARRPWRPVVSHPDTGRLYAEPTAKGVHTAIVVGPNGETEASGDAEHHTTPRGQVRVRFPWQQGER
PDDRSTGWLLVAQRQAGAGMGWQWLPRIGQEVLVKFQEDDIDQPVVIGALYNGQGEAGIAPTPGGQVAKG
VRQEADPETLYRLGSDSAASAQGNLAAGHSPAWHGLGTEAEGHRNAAALSGFKSAEHGGRGANLLVFDDS
DGQLRTQLATTQAYSQLNLGHLIHQQDNRRGSFRGQGFELRTDGYGAVRGHAGVLLTTYRDATSGKAVPT
GDNAAGIALIRQAKQLTSSLSQGATTHQTAALSTAKDDSAPLAQQEKAASGMVDGKALDAARQDAAAGNT
TTQGKVPHQSDATVQLAGRAGLVAIAGQDLQFASGESIALASGQDTNVAVGKQARLHAGQGIGVAAGLSK
AGDDNIGLQLTAGQDNLDVQAQHDALGLLSKDDLKLVSANLHVDFAAAKRIRLATAAGASITLEGGNIIV
ETPGRITYKAAQRSFAGPTHASRELNTWSHSAFDDRYVLRDQVTHEPLRNTQVELRRGDGAVLKLVTDGE
GRLPVQKGISMERVQLRVLGTLSGKT
 
Nucleotide Sequence: 3021 bp     [Download]
>gi|17548221|ref|NC_003296.1|:968930-971950 Ralstonia solanacearum GMI1000 plasmid pGMI1000MP, complete sequence
ATGGACGTAACGACCCTTCTCCAGAACCTCTTCGCTCCCGCGCACCGCCTGTACGCGCTGGAAGGCGAAG
GCCCGATCGCGGAGCTGGCGGTGGAGGCGTGGCTCGGTCGCGAGGCGTTGTCCGAGCTGTTCGAATGGCG
GGTGGTAGCGGCCAGCGCCAATGCGCGCTTCGCCCTCGAATCGTTCATCGGCCAGCGCGTGACGCTGGTC
ACCACGCTGGCCGACGGCACGCAGGCCCGGCGCACCGGCCTGATCCGGCAGGCCGAGCAGCTTGGCGCCG
ATGGCAGCCTCGCGCGCTATCGCCTGACCGTGGTGCCGTGGTTCTGGCTCGCCACCCAACAGCGGCACAG
CCAGGTGTTCCAGAACCGGCCGCTGGCGGACATCCTCGAACAGGTGCTGTCGCCGTATGCGCCCTATGCC
GCATGGCGCTTCGCCGCCGGCGCGGAAGACCGCATGGCGGCGTTCGGCACGCGTAGCCACATCGCTCAGT
TTCGCGAGACCGACTACCGCTTCGTCACGCGCCTGCTGGCCGAGGCGGGTCTGGGCTTCACCACCGTCGA
GGACGAGCAGGCCCCCAGCGGCCACGCGCTGCTGATCTTTGCCGACAGCCCCCGGCTGGCCGAGGACACG
GCATCCGCTGCCGAGGGCGGCATCCGCTACCACCGCGCGCACAGCCAGGAAGAACGCGACGCCATCCAGG
CGTTGATCTGCCATAGCCGCACAGCGGTCGGCGGAGTGGCGGTGGCGGCCTGGGATGCGCAGGCCAAGCG
GGCCTTCCGCGCGCACGTTCCCTCCCGGTTTTGCGGTATCGCGGGCAGCCCGGATGCCTATCTGTCGATC
AGCCCGTCGCTGGCGCCGGATACGGCCAACGCGCAGCGCATCGCCGAGCAGGTGATGGAGAGCGTCGAAG
CGCGCGCTCGCCTGTTCATCGGACGCGGCTCGGTGCGCACGCTGCGCAGCGGCACGCGACTGAAGATCGT
GGACTGCCCGCACCTGCCGAAGGACGTGGACGGCCCGTATCCGTTGCTGATCGACCTGGTGGAGCACTGC
GGCATCAACAACCTGACCGCCGATACGCAGGCAACATTGGCCCGGAAGCTGGGCGGGCTCGACGCCGCAC
TGACCTTCGACACGCCGCCCAGCCCCCCCGAATCCGGCCCCGGCCCGTTCGGCTTCATGGCGCCACACGA
GGTCATCGAACGCTTCACGCCGACGGCGGACCTGCTCACCGCTGCGCGCGCCCACGGCTACGCCGGCCAA
TTCCGCGCGGGTGACGCACGCCGGCCGTGGCGACCGGTCGTGTCGCATCCCGACACCGGCCGCCTGTACG
CCGAGCCCACCGCCAAGGGCGTACACACGGCCATCGTGGTCGGCCCGAACGGCGAGACCGAGGCCAGTGG
CGATGCGGAGCACCACACCACTCCACGGGGCCAGGTCCGCGTCCGCTTCCCGTGGCAGCAGGGCGAACGT
CCGGATGACCGCAGCACCGGCTGGCTGCTGGTCGCGCAGCGGCAGGCTGGGGCCGGCATGGGCTGGCAGT
GGCTGCCGCGCATCGGCCAGGAAGTGTTGGTCAAGTTCCAGGAAGACGATATCGACCAGCCGGTGGTGAT
CGGCGCGCTCTACAACGGCCAGGGCGAAGCGGGCATCGCGCCGACCCCGGGCGGGCAGGTCGCCAAGGGC
GTCAGGCAGGAGGCCGACCCGGAGACCCTCTACCGTTTGGGCAGCGACAGCGCCGCCAGCGCGCAGGGCA
ACCTCGCCGCCGGCCACAGCCCCGCATGGCACGGCCTGGGCACCGAGGCCGAAGGCCACCGCAACGCCGC
CGCCCTCAGCGGCTTCAAGAGCGCCGAGCATGGCGGGCGCGGCGCCAACCTGCTCGTCTTCGACGACAGC
GACGGGCAGTTGCGCACGCAGCTCGCCACCACGCAGGCTTACAGCCAACTCAACCTGGGCCACCTGATCC
ACCAGCAGGACAACCGGCGCGGCAGCTTCCGGGGCCAGGGCTTCGAGTTGCGCACCGATGGCTATGGCGC
GGTGCGCGGCCACGCCGGTGTGCTGCTGACCACCTACCGCGATGCCACGAGCGGCAAGGCTGTGCCGACC
GGCGACAACGCCGCCGGCATCGCGCTGATCCGGCAGGCCAAGCAACTGACGTCATCGTTGAGCCAGGGCG
CCACTACGCACCAGACCGCAGCGCTGTCCACCGCGAAGGACGACAGCGCACCGCTGGCCCAGCAGGAAAA
GGCCGCCTCGGGCATGGTCGACGGCAAAGCGCTCGATGCGGCCCGGCAGGACGCGGCCGCAGGCAACACC
ACCACGCAAGGCAAGGTGCCGCACCAGAGCGATGCGACTGTGCAGCTGGCCGGCCGCGCGGGCCTGGTGG
CGATCGCCGGGCAGGATCTGCAATTCGCCAGCGGCGAGAGCATCGCACTGGCCAGCGGCCAGGACACCAA
CGTCGCGGTGGGCAAGCAGGCGCGCCTCCACGCGGGGCAGGGCATCGGCGTGGCAGCGGGGCTGTCGAAG
GCGGGGGACGACAACATCGGCCTGCAGCTGACGGCGGGGCAGGACAACCTCGACGTGCAGGCGCAGCATG
ACGCGCTCGGGCTGCTGTCCAAGGACGACCTGAAGCTGGTGTCGGCGAATCTGCATGTGGACTTCGCGGC
GGCCAAGCGGATCCGGCTGGCGACGGCGGCGGGGGCGTCGATCACGCTGGAGGGCGGAAACATCATCGTC
GAGACGCCGGGGCGGATTACGTACAAGGCGGCGCAGCGCAGCTTTGCGGGGCCCACGCACGCGTCGCGCG
AGCTGAACACGTGGTCGCACAGTGCGTTTGACGATCGATATGTTTTGCGCGACCAAGTCACGCACGAGCC
GCTGCGGAATACGCAGGTCGAATTGCGGCGCGGTGACGGTGCTGTACTCAAGCTGGTCACCGATGGAGAG
GGCCGCCTCCCTGTGCAGAAGGGTATTTCCATGGAGCGTGTGCAACTGCGCGTGCTGGGAACGCTCTCCG
GCAAAACCTAA
 Primer design