SecReT6
Protein ID: 186470769
SecReT6 ID274
T6SS typei4a
Gene symbol-
Locus tagBphy_5978
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]510771..511343 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDB2JVR4
KEGG IDbph:Bphy_5978
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.50E-56, Aligned region: 10..162
Protein Sequence: 190 a.a.     [Download]
>gi|186470769|ref|YP_001862087.1| unnamed protein product [Burkholderia phymatum STM815]
MSNSLQKWVGRNRPPRVQITYDVEVGDAVEKRELPLVVGLLADLSGQPATPLPKLKERRLVEIDRDNFDE
IMGKIAPRLDLSVPDTLKGEGNIKVELKFEKFQDFHPESIVNQVPRLARLLEARQQLRDLLAKLDGNDEL
DSMLERIVQNSEELKKVQSQAHASDAPVAASAASDAVAEPAAAPDDAPAA
 
Nucleotide Sequence: 573 bp     [Download]
>gi|186470346|ref|NC_010625.1|:510771-511343 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGTCGAATAGTTTGCAGAAGTGGGTGGGACGCAATCGTCCGCCGCGTGTCCAGATCACCTACGACGTAG
AAGTCGGCGACGCGGTTGAGAAGCGCGAGCTTCCGCTAGTGGTCGGTTTGCTGGCGGACCTCTCGGGACA
GCCTGCAACGCCGCTCCCCAAGCTCAAGGAACGTCGTCTGGTCGAGATCGACCGTGACAACTTCGATGAG
ATCATGGGCAAGATCGCCCCGCGTCTCGACCTCTCCGTGCCGGACACGCTCAAGGGCGAGGGCAACATCA
AGGTCGAACTGAAGTTCGAGAAGTTCCAGGATTTCCATCCCGAAAGCATCGTCAACCAGGTGCCGCGCCT
CGCCAGGCTGCTCGAAGCGCGTCAGCAGCTGCGCGATCTGCTCGCCAAGCTCGACGGTAACGACGAACTC
GATTCGATGCTCGAGCGTATCGTCCAGAACAGCGAGGAACTGAAGAAAGTTCAAAGTCAGGCGCATGCCA
GCGATGCTCCCGTGGCTGCATCGGCGGCATCCGACGCAGTCGCAGAGCCGGCTGCTGCCCCGGACGACGC
ACCTGCCGCCTGA
 Primer design