SecReT6
Protein ID: 186470770
SecReT6 ID274
T6SS typei4a
Gene symbol-
Locus tagBphy_5979
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]511410..512918 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB2JVR5
KEGG IDbph:Bphy_5979
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.30E-179, Aligned region: 75..498
Protein Sequence: 502 a.a.     [Download]
>gi|186470770|ref|YP_001862088.1| unnamed protein product [Burkholderia phymatum STM815]
MASNTAAGGAARETQTLDASAGAELSLLERIVHEGNMAVEPSQSGYAKKLIGQLASQILDEGMRTSPDKS
VVAMINERVAEIDKLLSDQLNAIMHDEAFQALEASWTGLHDMVYGTETGPQLKLRLLNVTKKELLKDLET
AVDHDMSTLFKKIYEEEYGTFGGAPYSLLIGDYSFGRHPQDIALLERISKVAAAAHAPFIASAAPGLFDL
KSFTDLGVTRDLSKTFESAELAAWRSFRDSEDSRYVSLVLPSYAARLPYGAKTKPVENFNFEEDVDGTDH
GKYLWANSAYQLGLRITDAFAKYSWATAIRGVEGGGKVDNMVAHTYKTGEGDIVLKCPTEVTITDRREKE
LNDLGFIALVNSKGSNFATFFGGQTTNRPKVYNKDAANANAQLSARLPYVLAASRFAHYMKVIMRDKVGS
FQSRSDIESYLNNWVADYVLINPSASHAQKARFPLGEARVDVTEVPGKPGAYRATCFLKPHFQMEELTAS
IRLVAELPAAAA
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|186470346|ref|NC_010625.1|:511410-512918 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGGCAAGCAACACTGCGGCCGGCGGCGCCGCACGCGAAACGCAGACACTCGACGCTTCAGCGGGTGCGG
AACTGAGCCTGCTCGAGCGCATCGTTCATGAAGGCAACATGGCGGTCGAGCCGTCGCAAAGCGGCTACGC
GAAAAAGCTGATCGGTCAGCTCGCTTCGCAGATTCTCGACGAAGGCATGCGCACCAGCCCGGACAAGAGC
GTGGTCGCAATGATCAACGAACGTGTCGCTGAAATCGACAAATTGCTGTCGGACCAGCTAAACGCAATCA
TGCACGATGAAGCGTTCCAGGCGCTCGAAGCCTCATGGACAGGCTTGCATGATATGGTCTACGGCACCGA
AACCGGACCGCAATTGAAGCTTCGCCTGCTGAATGTGACGAAGAAGGAACTGCTCAAGGACCTTGAAACG
GCCGTCGACCACGACATGAGCACGCTCTTCAAGAAAATCTATGAAGAGGAATACGGCACATTCGGTGGTG
CACCGTATTCGCTGCTGATCGGCGACTATTCGTTTGGCCGTCATCCGCAGGATATCGCGCTGCTCGAGCG
TATCTCCAAAGTGGCTGCTGCCGCGCACGCTCCGTTTATTGCTTCAGCAGCGCCTGGACTGTTCGATCTG
AAATCATTTACGGACCTCGGCGTCACCCGCGATCTGTCGAAGACCTTCGAAAGCGCCGAACTCGCCGCAT
GGCGCAGCTTCCGCGATTCGGAAGACTCGCGTTATGTTTCTCTGGTGCTGCCTTCGTATGCCGCGCGCCT
GCCGTACGGAGCGAAGACGAAGCCCGTCGAGAACTTCAATTTCGAAGAAGATGTAGACGGTACGGATCAC
GGCAAGTATCTTTGGGCAAACTCGGCTTACCAGCTCGGCCTGCGCATCACCGATGCGTTCGCGAAGTACA
GCTGGGCGACGGCGATCCGCGGCGTGGAAGGCGGTGGCAAGGTCGACAACATGGTGGCGCACACGTACAA
GACCGGCGAAGGCGACATCGTTCTCAAATGCCCGACTGAAGTAACGATCACGGATCGTCGCGAGAAGGAA
CTGAACGACCTCGGTTTCATCGCACTGGTGAATTCGAAAGGCTCGAACTTCGCGACCTTCTTCGGCGGTC
AGACGACCAACCGTCCCAAGGTCTACAACAAGGATGCCGCCAATGCCAACGCGCAGCTTTCGGCTCGCCT
GCCGTACGTGCTCGCCGCGTCGCGCTTCGCGCACTACATGAAAGTGATCATGCGCGACAAGGTCGGAAGT
TTCCAGTCGCGCAGCGATATCGAATCTTATCTGAACAACTGGGTTGCCGATTACGTACTGATCAATCCCT
CGGCGTCGCACGCTCAGAAGGCGCGTTTCCCGCTGGGCGAAGCACGTGTGGACGTGACGGAAGTGCCGGG
CAAGCCGGGCGCATACCGCGCGACCTGCTTCCTGAAACCGCATTTCCAGATGGAAGAGTTGACCGCGTCG
ATTCGTCTCGTCGCGGAACTGCCGGCAGCGGCAGCCTGA
 Primer design