SecReT6
Protein ID: 186470771
SecReT6 ID274
T6SS typei4a
Gene symbol-
Locus tagBphy_5980
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]512987..513475 [+]
Producthypothetical protein
NoteTssD
UniProt IDB2JVR6
KEGG IDbph:Bphy_5980
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.40E-33, Aligned region: 6..134
Protein Sequence: 162 a.a.     [Download]
>gi|186470771|ref|YP_001862089.1| unnamed protein product [Burkholderia phymatum STM815]
MDTVLLKIKDIKGNSTLDGAADQIVLYSYSIGVAMTMNRDVGNTERTMGRPSFQEFGLTKATDQATPALY
SACAAGTKLGDATISIGRNENGKFMSLLQYTLSDAMISTIATSGSGESVDSFSINFSKITTVYTQQNVDS
TKKGTASFGWDLSKNVSAPPAG
 
Nucleotide Sequence: 489 bp     [Download]
>gi|186470346|ref|NC_010625.1|:512987-513475 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGGATACCGTTCTTCTTAAGATCAAGGACATCAAGGGCAATTCGACGCTCGACGGCGCGGCAGATCAAA
TCGTCCTGTACTCGTATTCGATTGGCGTCGCAATGACGATGAACCGTGACGTGGGCAACACGGAGCGCAC
GATGGGCCGCCCGAGCTTCCAGGAGTTCGGTCTCACCAAGGCGACCGATCAGGCCACGCCGGCACTCTAT
TCAGCATGTGCGGCGGGCACCAAGCTCGGCGATGCGACGATTTCGATCGGTCGCAACGAAAACGGCAAGT
TCATGTCTCTGCTGCAGTACACGTTGAGCGACGCGATGATCTCGACGATCGCAACCAGCGGCAGCGGTGA
ATCGGTCGACAGCTTCTCCATCAACTTCTCGAAGATTACGACCGTCTACACGCAGCAGAACGTCGACTCG
ACCAAAAAGGGTACGGCTTCTTTCGGCTGGGATCTGTCGAAGAACGTGTCGGCGCCGCCGGCGGGCTGA
 Primer design