SecReT6
Protein ID: 186470772
SecReT6 ID274
T6SS typei4a
Gene symbol-
Locus tagBphy_5981
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]513551..514006 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB2JVR7
KEGG IDbph:Bphy_5981
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.40E-17, Aligned region: 27..124
Protein Sequence: 151 a.a.     [Download]
>gi|186470772|ref|YP_001862090.1| unnamed protein product [Burkholderia phymatum STM815]
MPAIVSSSSMPLFDRLAASGDAQLSGAHALRESVARELSRLLNTRSRLTIEAFLESEGTVLEYGVPDFSE
RSLHSGPDRDAIASVVKRAITLFEPRLVNIVVGFVFPSEYSAHAVLTIGADIRSGADVAHVAFDMATDGH
VVASTRGADEG
 
Nucleotide Sequence: 456 bp     [Download]
>gi|186470346|ref|NC_010625.1|:513551-514006 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGCCGGCAATCGTCAGCAGTTCATCGATGCCATTATTTGACCGCCTCGCCGCGAGCGGCGACGCACAGC
TCTCTGGCGCCCATGCGCTGCGGGAGTCGGTTGCGCGCGAGCTCAGCAGACTGCTCAACACGCGGTCGCG
CCTGACAATCGAAGCGTTTTTAGAAAGCGAAGGCACGGTACTGGAGTATGGCGTGCCGGACTTCTCCGAA
AGATCCCTGCATTCCGGCCCGGACCGGGACGCGATTGCCAGTGTCGTCAAACGCGCGATCACGCTATTCG
AGCCGCGCCTTGTCAATATCGTCGTGGGCTTTGTATTTCCTTCGGAGTACTCGGCGCACGCCGTGCTGAC
CATCGGCGCGGATATACGCTCGGGCGCGGACGTTGCGCACGTGGCGTTCGACATGGCCACGGACGGTCAT
GTTGTCGCCAGTACGCGCGGCGCGGATGAAGGCTGA
 Primer design