SecReT6
Protein ID: 186470773
SecReT6 ID274
T6SS typei4a
Gene symbol-
Locus tagBphy_5982
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]513996..515765 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDB2JVR8
KEGG IDbph:Bphy_5982
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.60E-189, Aligned region: 11..589
Protein Sequence: 589 a.a.     [Download]
>gi|186470773|ref|YP_001862091.1| unnamed protein product [Burkholderia phymatum STM815]
MKADMAPDDILQYYKRELSYLRLQGADFARRYPKIASRLALHGTESLDPHTERLIEATAFLAARVHRDLD
QEFPQVASALLDNVCPSLVQPVPSMTVAQFDLDPTQGKVTAGFLVPRHTGLQARTETGDTCRFRSAWDAV
LWPLKISHAAFGDDATLRLTLECAPGVDFSELELKQLRIHLHGDWMVTMPLYELLVSGVADVSVRPEGRP
SASLLPARAWREVGYAQADDVLPRPPNAQPAYSLMQEYFAFPRKFHFFDLHHLEGRLGSGRRCEVVFHLD
RSPRGLGMLRAEHFQLGCTPIVNLFSQTSEPIVIDHRHYEYRLVADHRRESMTEIHSVASVVASDPSTDR
VEHVPCFSAIDHVHTDGNTVFWSARREHSLRENVHGTDTFLSFVNAANTQSDPGTPVIYANVLCTNRRLA
EQVPVGARMLLEKVSQNTRVRCLYEPTAQRSPSLGSETLWRLISLLTLNYHSLVSGATGRAQLQEMLRLF
ASESTREQDQIRGIRSVEARSVTAHVGSDAWRGYCRGTEVAVEFDPETFVGGSPLLLGAVLARFFAMYTS
VNSFVRLVVRRGDETWKQWEPMTGCQQLL
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|186470346|ref|NC_010625.1|:513996-515765 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGAAGGCTGACATGGCGCCCGACGACATCCTGCAATACTACAAACGCGAACTGTCGTACCTGCGTCTGC
AAGGCGCGGACTTCGCACGCCGCTATCCGAAGATTGCATCGCGGCTCGCGTTGCACGGCACGGAATCGCT
CGACCCGCACACGGAGCGGCTGATCGAAGCGACGGCGTTTCTCGCTGCTCGCGTGCACCGCGATCTCGAT
CAGGAATTCCCGCAGGTCGCGTCAGCGCTGCTCGACAACGTGTGTCCCTCGCTCGTACAACCCGTGCCAT
CGATGACCGTCGCGCAGTTCGATCTCGATCCGACTCAGGGCAAAGTGACGGCGGGTTTTCTGGTGCCGCG
TCACACCGGACTGCAGGCGCGCACGGAAACAGGCGATACGTGCCGCTTCCGCAGTGCATGGGACGCGGTG
CTGTGGCCGCTGAAGATCAGTCATGCCGCATTCGGTGACGATGCGACGCTGCGGCTCACGCTTGAGTGCG
CGCCGGGCGTCGACTTTTCCGAGCTGGAACTGAAGCAACTACGCATTCACCTCCACGGCGACTGGATGGT
CACGATGCCGCTCTATGAATTGCTGGTGTCGGGTGTTGCGGACGTGTCGGTGCGGCCCGAAGGCCGTCCG
TCGGCGTCGCTGCTGCCAGCGCGTGCGTGGCGCGAAGTCGGGTATGCGCAAGCCGACGATGTGCTGCCGC
GCCCACCCAATGCACAGCCGGCCTATTCGCTGATGCAGGAATACTTCGCCTTCCCGCGCAAGTTCCATTT
CTTCGATCTTCATCACCTGGAAGGCCGGCTAGGATCGGGGCGCCGCTGCGAAGTCGTGTTTCATCTTGAC
CGTTCGCCGCGCGGCCTCGGCATGCTGCGCGCTGAACATTTTCAGCTTGGCTGCACGCCCATTGTCAATC
TGTTCTCGCAGACGAGCGAGCCGATCGTCATCGACCATCGGCACTATGAATACCGGCTCGTCGCCGATCA
TCGCCGCGAGTCGATGACGGAAATCCATTCGGTTGCATCCGTCGTCGCGTCGGACCCGTCGACCGATCGC
GTTGAGCACGTGCCGTGCTTTTCCGCGATCGATCATGTTCACACGGACGGCAACACCGTTTTCTGGTCGG
CGCGACGCGAACACAGCCTGCGCGAAAACGTCCATGGAACGGACACGTTCCTGAGTTTCGTCAATGCCGC
CAACACGCAAAGCGATCCCGGCACGCCCGTCATTTACGCGAACGTGCTGTGCACGAACCGCCGGCTTGCG
GAACAGGTGCCCGTGGGCGCGCGCATGCTGCTCGAAAAGGTGTCGCAGAACACCCGTGTTCGCTGCCTTT
ACGAACCGACAGCGCAGCGCAGTCCTTCGCTCGGTAGCGAGACCTTGTGGCGGCTGATTTCGCTGCTCAC
GCTCAACTATCACTCGCTGGTGAGCGGCGCGACGGGACGCGCGCAATTGCAGGAGATGCTGCGGCTTTTC
GCGTCCGAGAGCACGCGCGAGCAGGACCAGATTCGCGGCATCCGCAGTGTAGAAGCGCGCAGCGTCACCG
CGCACGTCGGCAGCGACGCGTGGCGCGGCTATTGCCGCGGCACCGAAGTCGCGGTCGAGTTCGACCCGGA
GACCTTCGTCGGCGGTTCGCCTTTGCTGCTGGGCGCCGTGCTCGCGCGTTTCTTTGCGATGTACACGTCG
GTCAATTCATTTGTACGGCTGGTGGTGCGCCGTGGAGACGAGACATGGAAGCAATGGGAGCCGATGACGG
GCTGCCAGCAGTTGCTCTGA
 Primer design