SecReT6
Protein ID: 186470774
SecReT6 ID274
T6SS typei4a
Gene symbol-
Locus tagBphy_5983
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]515720..516853 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDB2JVR9
KEGG IDbph:Bphy_5983
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-82, Aligned region: 21..350
Protein Sequence: 377 a.a.     [Download]
>gi|186470774|ref|YP_001862092.1| unnamed protein product [Burkholderia phymatum STM815]
MEAMGADDGLPAVALIARLKANPQSFDLFQAISLLERAAPWARPLGRGNGLGEAVRFAGHVSLAFEASDI
RSVREHAVPPDEAHARPAHEDEHASRERRGPYASYTVTTPVLTLAGANGPLPMAYTELVLARRAQRDTAT
ADLLDIFNHRFLSFLYRSRKKHAPGLNWRSPHGSALAAALDALSNLGLRAGVNAAVRGPQGARLWMRHAG
LLGAAPRSMTGLLAMLSDRLGLEVQGAQFVGGWREIDAADSLRLAGARSRAPRLGGAAVLGRRTWDEASG
ICIEFPGLTKEQFEALLPGGRDHAMAAWLIRSYLQQDFDVQFVLHLAPQPVACAAGGARAARLGWTSWLG
GARHDTHTPEPVRLAMREATASTPTNL
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|186470346|ref|NC_010625.1|:515720-516853 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGGAAGCAATGGGAGCCGATGACGGGCTGCCAGCAGTTGCTCTGATCGCCCGTCTCAAGGCGAATCCGC
AGAGCTTCGATCTGTTCCAGGCGATCAGCCTCCTGGAGCGGGCCGCGCCTTGGGCGCGTCCGCTCGGACG
GGGCAATGGGCTCGGCGAAGCCGTGCGTTTTGCCGGTCACGTCTCGCTCGCATTCGAGGCGAGCGATATC
CGCAGTGTGCGCGAACATGCCGTGCCGCCAGACGAGGCGCACGCCCGCCCCGCACACGAAGATGAACACG
CGTCGCGTGAGCGGCGCGGGCCGTATGCGAGCTATACGGTCACGACGCCCGTGCTCACGCTGGCAGGCGC
GAACGGCCCGCTACCGATGGCCTATACCGAGCTGGTGCTTGCGCGCCGGGCGCAACGGGACACGGCGACG
GCAGACCTGCTCGACATCTTCAATCACCGATTCCTGTCGTTCCTCTATCGCAGCCGCAAGAAGCATGCGC
CGGGCTTGAACTGGCGCTCGCCGCACGGCTCTGCGCTCGCTGCGGCGCTGGATGCACTGAGCAATCTCGG
CTTGCGGGCAGGCGTGAATGCCGCCGTGCGCGGGCCGCAGGGCGCGCGTCTGTGGATGCGGCATGCGGGC
CTGCTCGGCGCTGCGCCCCGATCGATGACCGGCCTGCTCGCGATGCTCTCCGATCGCCTCGGTCTCGAGG
TGCAGGGTGCGCAGTTCGTCGGCGGCTGGCGCGAGATCGACGCAGCCGATTCGCTGCGCCTTGCCGGCGC
CCGTTCGCGCGCGCCGCGTCTGGGCGGCGCGGCCGTGCTCGGACGACGCACCTGGGACGAGGCAAGCGGC
ATCTGCATCGAGTTTCCCGGACTGACGAAAGAACAGTTCGAAGCGCTGCTGCCGGGCGGCCGCGATCACG
CAATGGCGGCCTGGTTGATCCGCTCTTATCTGCAGCAGGACTTCGACGTTCAGTTCGTGCTACATCTCGC
GCCGCAACCGGTCGCCTGCGCAGCAGGCGGTGCGCGTGCGGCCCGGCTTGGCTGGACATCCTGGCTGGGC
GGCGCGCGTCACGACACCCACACGCCGGAGCCGGTGCGCCTCGCCATGCGCGAAGCGACCGCTTCCACGC
CGACGAATCTTTAA
 Primer design