SecReT6
Protein ID: 186470775
SecReT6 ID274
T6SS typei4a
Gene symbol-
Locus tagBphy_5984
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]516865..519594 [+]
Producttype VI secretion ATPase
NoteTssH
UniProt IDB2JVS0
KEGG IDbph:Bphy_5984
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-38, Aligned region: 250..269
AAA_2 [PF07724], Evalue: 1.40E-38, Aligned region: 637..801
AAA [PF00004], Evalue: 6.00E-20, Aligned region: 250..382
AAA [PF00004], Evalue: 6.00E-20, Aligned region: 480..503
AAA [PF00004], Evalue: 6.00E-20, Aligned region: 643..764
AAA_16 [PF13191], Evalue: 6.00E-14, Aligned region: 228..273
AAA_16 [PF13191], Evalue: 6.00E-14, Aligned region: 294..329
AAA_16 [PF13191], Evalue: 6.00E-14, Aligned region: 388..446
AAA_16 [PF13191], Evalue: 6.00E-14, Aligned region: 611..661
AAA_16 [PF13191], Evalue: 6.00E-14, Aligned region: 705..731
ClpB_D2-small [PF10431], Evalue: 5.50E-13, Aligned region: 393..417
ClpB_D2-small [PF10431], Evalue: 5.50E-13, Aligned region: 809..880
AAA_5 [PF07728], Evalue: 1.40E-12, Aligned region: 250..274
AAA_5 [PF07728], Evalue: 1.40E-12, Aligned region: 642..752
AAA_22 [PF13401], Evalue: 1.60E-10, Aligned region: 249..336
AAA_22 [PF13401], Evalue: 1.60E-10, Aligned region: 375..421
AAA_22 [PF13401], Evalue: 1.60E-10, Aligned region: 641..734
Sigma54_activat [PF00158], Evalue: 6.70E-06, Aligned region: 245..329
Sigma54_activat [PF00158], Evalue: 6.70E-06, Aligned region: 642..762
IstB_IS21 [PF01695], Evalue: 6.90E-06, Aligned region: 231..273
IstB_IS21 [PF01695], Evalue: 6.90E-06, Aligned region: 642..660
AAA_17 [PF13207], Evalue: 9.10E-06, Aligned region: 250..299
AAA_17 [PF13207], Evalue: 9.10E-06, Aligned region: 641..678
AAA_14 [PF13173], Evalue: 2.30E-05, Aligned region: 250..353
AAA_14 [PF13173], Evalue: 2.30E-05, Aligned region: 641..723
AAA_19 [PF13245], Evalue: 6.80E-05, Aligned region: 250..272
AAA_19 [PF13245], Evalue: 6.80E-05, Aligned region: 640..664
Clp_N [PF02861], Evalue: 0.0001, Aligned region: 23..74
Clp_N [PF02861], Evalue: 0.0001, Aligned region: 107..124
Clp_N [PF02861], Evalue: 0.0001, Aligned region: 337..347
AAA_18 [PF13238], Evalue: 0.00012, Aligned region: 250..273
AAA_18 [PF13238], Evalue: 0.00012, Aligned region: 643..671
Arch_ATPase [PF01637], Evalue: 0.00025, Aligned region: 229..270
Arch_ATPase [PF01637], Evalue: 0.00025, Aligned region: 303..404
Arch_ATPase [PF01637], Evalue: 0.00025, Aligned region: 641..654
AAA_29 [PF13555], Evalue: 0.00029, Aligned region: 242..265
AAA_29 [PF13555], Evalue: 0.00029, Aligned region: 640..667
AAA_25 [PF13481], Evalue: 0.00029, Aligned region: 245..325
AAA_25 [PF13481], Evalue: 0.00029, Aligned region: 640..663
NACHT [PF05729], Evalue: 0.00051, Aligned region: 250..277
NACHT [PF05729], Evalue: 0.00051, Aligned region: 642..666
NACHT [PF05729], Evalue: 0.00051, Aligned region: 834..863
Zeta_toxin [PF06414], Evalue: 0.0006, Aligned region: 250..270
Zeta_toxin [PF06414], Evalue: 0.0006, Aligned region: 641..682
RNA_helicase [PF00910], Evalue: 0.005, Aligned region: 251..271
RNA_helicase [PF00910], Evalue: 0.005, Aligned region: 643..664
DUF815 [PF05673], Evalue: 0.0078, Aligned region: 244..325
DUF815 [PF05673], Evalue: 0.0078, Aligned region: 599..680
SRP54 [PF00448], Evalue: 0.0091, Aligned region: 250..274
SRP54 [PF00448], Evalue: 0.0091, Aligned region: 641..675
Protein Sequence: 909 a.a.     [Download]
>gi|186470775|ref|YP_001862093.1| unnamed protein product [Burkholderia phymatum STM815]
MDIDIRTLLSRLNPECKLAMEQAAQLCVRQTHYNVDVEHLLLTLLESDAPDLRAILAHFDIKPETLTAQL
QKAVDLFKRGNGRTPALSPNFSPLFQEAWLLSSMLLGEQQVRSGTLILALLEVGSLRGMLLESAPALLKI
PRASLREQIGMIVAGSAEDAGGAQARASAAPGAGQPGPASSAAAPQLDGGMPTMPSGATASQGRQTALDQ
YTVDLTGFAREGKIDPIRGRDAEIRQLIDVLLRRRQNNPILTGEAGVGKTAVVEGFAQRIVQGDVPPALA
NVSVRSLDLALLQAGAGVKGEFENRLKSVIAEVKASPAPVILFIDEAHQLIGAGGSEGQGDAANLLKPAL
ARGELRTIAATTWAEYKKYVERDPALARRFQVVKVEEPSEAVAIEMLRGMVQKLEEHHGVEILDEAVRDA
VKLSHRYISGRQLPDKAISVLDTACARVAIGQNGLPEDIEALGRSIETAENQLRIARHEAATGAERADVM
AGLVKQLEDERAQHVRLTEKLTTEKRAVEEILAWRKKIRGYLTNQNDVLEAEDGESLTANLSRLEKGLEA
VQNDEPMVPVCVDSETVAKVISGWTGIPVGRMLADELHTVLYLQDKLAERVVGQDEALDAIARRVRTFRA
DLDDPGKPVGVFLLVGPSGVGKTETAFALADMLYGGERNMITVNMSEFQEAHSVSGLKGAPPGYVGYGRG
GVLTEAVRRRPYSVLLLDEMEKAHPDVLELFFQVFDKGVMEDGEGVPIDFKNTLILLTSNAAQDVITDAC
RGGRRPPPEELIEKLRPALLKQFSPAFLGRLVLVPYYHLGDAQINAIVNLKLERLAQRFSRNHHAPLTWD
EGLATLIAQRCKEVDSGARNVDHILTQSVLPELARQVLERISISEPFGGVHLALSAAGDIAFRFLPKEA
 
Nucleotide Sequence: 2730 bp     [Download]
>gi|186470346|ref|NC_010625.1|:516865-519594 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGGACATCGATATCCGCACCCTGTTGAGCCGGCTCAATCCGGAATGCAAGCTTGCGATGGAGCAGGCGG
CGCAACTGTGTGTGCGTCAGACGCACTACAACGTCGACGTCGAGCATCTTCTGTTGACGCTGCTCGAATC
CGATGCGCCTGACCTGCGCGCCATTCTTGCGCACTTCGACATCAAACCCGAAACGCTCACCGCACAACTC
CAGAAGGCCGTCGATCTTTTCAAGCGGGGCAATGGCCGCACGCCCGCGCTGTCGCCGAATTTTTCTCCGC
TCTTCCAGGAGGCGTGGCTGCTGAGTTCGATGCTCCTCGGCGAGCAACAGGTCCGCTCGGGCACGCTCAT
CCTGGCGCTACTCGAAGTGGGCAGTCTGCGCGGCATGCTGCTTGAATCCGCGCCCGCCTTGCTCAAGATT
CCGCGCGCGAGCCTGCGCGAGCAGATCGGCATGATCGTCGCGGGCTCGGCGGAAGATGCGGGCGGTGCGC
AGGCGCGTGCGTCGGCCGCGCCGGGAGCGGGGCAACCGGGCCCCGCGAGCTCCGCTGCTGCACCGCAGTT
GGACGGCGGTATGCCGACCATGCCTTCTGGCGCTACCGCGAGCCAGGGTCGTCAAACCGCACTCGATCAA
TACACGGTCGATCTGACGGGGTTCGCCCGCGAGGGCAAAATTGACCCGATCCGTGGACGCGATGCGGAGA
TCCGGCAGCTGATCGATGTGCTGCTGCGTCGCCGTCAGAACAACCCGATCCTGACGGGCGAGGCGGGAGT
CGGGAAGACAGCCGTCGTCGAAGGTTTCGCACAGCGCATCGTTCAGGGCGACGTGCCGCCCGCGCTGGCC
AACGTTTCCGTTCGTTCGCTCGATCTTGCGCTGTTGCAAGCGGGAGCCGGGGTGAAGGGTGAGTTCGAGA
ACCGGCTCAAATCGGTGATCGCCGAGGTCAAAGCGTCGCCCGCGCCTGTGATTCTTTTCATTGACGAAGC
GCACCAACTGATTGGCGCGGGCGGTAGCGAAGGCCAAGGCGACGCCGCGAACCTTCTCAAGCCGGCATTG
GCGCGTGGCGAACTGCGTACCATTGCCGCCACGACGTGGGCCGAATACAAGAAATACGTTGAGCGCGATC
CGGCGCTTGCGCGCCGCTTCCAGGTCGTCAAGGTCGAGGAGCCGAGTGAGGCTGTCGCGATCGAGATGCT
GCGCGGCATGGTTCAGAAACTGGAAGAACATCACGGCGTCGAGATTCTCGACGAAGCGGTGCGAGATGCC
GTGAAGCTCTCGCACCGATACATCTCCGGGCGCCAGTTGCCGGACAAGGCGATCAGCGTGCTTGATACGG
CCTGCGCGCGTGTCGCGATTGGTCAGAACGGCTTGCCCGAGGACATCGAGGCACTGGGCCGTTCGATCGA
GACGGCCGAAAACCAGCTTCGTATCGCGCGTCACGAAGCCGCAACGGGCGCTGAGCGCGCCGACGTGATG
GCTGGGCTGGTGAAGCAACTGGAAGACGAGCGCGCGCAGCACGTGCGTCTCACCGAAAAGCTCACAACCG
AAAAGCGGGCGGTGGAAGAGATCCTCGCATGGCGCAAGAAAATTCGAGGCTATCTGACGAATCAGAACGA
TGTGCTGGAAGCCGAAGATGGCGAGTCGCTGACGGCGAATCTCTCGCGACTGGAGAAAGGGCTCGAGGCC
GTGCAAAACGACGAGCCGATGGTCCCCGTGTGTGTCGATTCGGAAACGGTCGCGAAGGTGATATCCGGCT
GGACGGGCATTCCTGTTGGCCGGATGCTCGCAGATGAGCTCCACACCGTGCTGTATCTGCAGGACAAGCT
TGCGGAACGCGTCGTCGGCCAGGACGAGGCGCTTGACGCCATTGCGCGCCGGGTGCGCACCTTCCGTGCG
GATCTCGACGATCCAGGCAAGCCCGTTGGCGTCTTCCTGCTCGTCGGACCCAGCGGCGTCGGCAAGACGG
AAACGGCGTTTGCGCTTGCCGACATGCTGTACGGCGGCGAACGCAACATGATCACCGTCAATATGTCCGA
GTTCCAGGAGGCGCATAGCGTTTCGGGACTCAAGGGCGCGCCGCCGGGCTATGTCGGATACGGCCGCGGC
GGCGTGCTGACCGAGGCGGTGCGACGCCGCCCCTACAGCGTGCTGCTGCTCGACGAAATGGAGAAGGCGC
ATCCCGACGTGCTCGAGCTATTCTTCCAGGTGTTCGACAAGGGCGTGATGGAGGACGGCGAGGGCGTTCC
CATCGACTTCAAGAACACGCTGATCCTGCTTACGTCGAATGCCGCGCAGGATGTGATCACCGACGCATGC
CGGGGCGGGCGCCGCCCGCCGCCCGAAGAGCTGATAGAGAAACTGCGCCCCGCGCTCCTCAAACAGTTCA
GCCCCGCATTCCTCGGCCGGCTCGTACTCGTGCCGTACTACCACCTCGGCGACGCGCAGATCAACGCAAT
CGTCAACCTCAAGCTCGAACGGCTCGCGCAGCGATTTTCGCGTAACCATCACGCGCCCCTCACGTGGGAC
GAAGGTCTCGCCACGCTGATCGCGCAACGCTGCAAGGAAGTGGACAGCGGCGCGCGCAACGTCGACCACA
TTCTTACGCAGTCGGTGCTTCCGGAACTGGCGCGCCAGGTGCTCGAGAGAATCTCGATATCGGAGCCGTT
CGGCGGCGTGCATCTTGCGCTGAGCGCAGCGGGCGACATCGCGTTCCGCTTCCTGCCCAAGGAGGCGTAA
 Primer design