SecReT6
Protein ID: 186470776
SecReT6 ID274
T6SS typei4a
Gene symbol-
Locus tagBphy_5985
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]519599..521524 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB2JVS1
KEGG IDbph:Bphy_5985
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-69, Aligned region: 31..328
Phage_base_V [PF04717], Evalue: 9.50E-23, Aligned region: 357..450
Gp5_C [PF06715], Evalue: 1.80E-10, Aligned region: 492..514
Gp5_C [PF06715], Evalue: 1.80E-10, Aligned region: 510..523
Gp5_C [PF06715], Evalue: 1.80E-10, Aligned region: 526..547
Gp5_C [PF06715], Evalue: 1.80E-10, Aligned region: 558..580
Gp5_C [PF06715], Evalue: 1.80E-10, Aligned region: 614..627
Protein Sequence: 641 a.a.     [Download]
>gi|186470776|ref|YP_001862094.1| unnamed protein product [Burkholderia phymatum STM815]
MSTTPSQANCFASVSTPFGTDVLLLDGFGGREAIAELFHFDLRMRSTNKALDPQQIVGKSATVTLKDHTG
VARYFNGIVTRFAHAGADVQYGFYSAELAPRLWLLSLGQDRVIWQNLSALEIIKKVLGTFGVTFEDRTKH
SSNYLAREYCVQYDESAFRFISRLMEEEGIFYFFTFADGAHTMVLADDPSAHEATVAGTLYFAPDPSVGQ
QIQRLSAFEMSRGVVAGEHIVSDYDYTQAATLLSSSKGASSIPTGTRFTFPGKYVAASHGDQIAGTRLQA
HHVAQQTGRGEGAYYGLAAGTTFTLSGHPDSALNVSYVVRAVQHAASNMTYGNEFDVIPVTVPFRAPLVT
PRPIVSGTHTAKVVGPSDEEIWTDSQGRIKLKFYWDRTPDADQNSSCWVRVAQASAGPGWGHLFLPRIGE
EVVVSYVDGDPDRPLVTGCVYNGTNAVPVTLPSMQTQSVIRSRSSKGGTAGNEIRMEDKLNSEELYVHAQ
KDMSVEIENALSTTVKAGAETHVVLKGDRSVEVSEGKETHTVKGTRTLDVTGDETHTNHAAFAHNVSGNH
THKIDGNYTLKVGGNLVIEVSGSISIKAGTSLSSEAGTSHASKAGTTLSSEGMTVSHKASATQTVDGGGQ
LALKGGIVQLN
 
Nucleotide Sequence: 1926 bp     [Download]
>gi|186470346|ref|NC_010625.1|:519599-521524 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGTCCACAACGCCCAGCCAGGCGAACTGCTTTGCCTCCGTCTCGACACCGTTCGGAACGGATGTGCTGC
TGCTCGACGGATTCGGAGGCCGCGAAGCGATAGCGGAGTTGTTTCATTTCGATCTGCGCATGCGCTCGAC
GAACAAGGCACTCGACCCTCAGCAAATCGTCGGCAAGAGCGCAACGGTGACGCTGAAGGACCACACAGGC
GTCGCCCGCTATTTCAATGGAATCGTCACACGCTTCGCGCACGCGGGCGCGGACGTGCAATACGGGTTCT
ATTCTGCTGAACTGGCTCCGCGTCTGTGGCTGCTCTCGCTGGGTCAGGACCGTGTCATCTGGCAGAACCT
GAGCGCACTCGAGATCATCAAGAAGGTGCTGGGTACGTTCGGCGTGACTTTCGAGGACCGCACGAAGCAC
AGCAGCAACTACCTCGCGCGCGAATACTGCGTCCAGTACGACGAAAGTGCGTTCCGGTTCATCTCGCGCC
TGATGGAAGAAGAGGGCATCTTCTACTTCTTCACATTCGCGGACGGCGCGCACACGATGGTGCTGGCGGA
CGATCCATCGGCGCACGAAGCCACGGTGGCAGGAACACTCTATTTCGCGCCCGATCCGAGCGTCGGCCAG
CAGATCCAGCGCCTCAGCGCGTTTGAAATGTCGCGCGGCGTGGTGGCGGGCGAGCACATTGTCAGCGACT
ACGACTACACGCAGGCGGCCACGTTGCTTTCGTCGTCGAAGGGTGCTTCGAGCATTCCGACGGGGACGCG
TTTCACCTTCCCCGGCAAATATGTCGCGGCTTCGCACGGCGACCAGATCGCCGGCACACGTCTCCAGGCA
CATCATGTCGCGCAGCAGACGGGACGGGGCGAGGGCGCATATTACGGCCTCGCGGCAGGCACGACGTTCA
CGTTGAGCGGTCATCCTGACAGCGCACTCAATGTGAGCTACGTCGTGCGCGCCGTGCAGCACGCGGCATC
GAACATGACGTATGGCAACGAATTCGACGTCATCCCCGTCACCGTGCCGTTTCGCGCTCCCCTTGTTACG
CCACGGCCCATCGTATCGGGTACGCATACGGCAAAAGTGGTGGGGCCGTCGGACGAAGAGATCTGGACCG
ACTCGCAAGGGCGCATCAAGCTCAAGTTCTACTGGGACCGCACGCCTGATGCCGACCAGAACAGCTCCTG
CTGGGTGCGCGTGGCACAGGCATCGGCGGGGCCGGGGTGGGGGCATCTGTTTCTGCCGCGCATCGGCGAG
GAAGTGGTGGTCAGCTATGTCGACGGCGATCCCGACCGCCCGCTTGTGACGGGTTGTGTCTACAACGGCA
CGAACGCTGTGCCGGTGACTTTGCCGTCGATGCAAACGCAAAGCGTGATCCGCTCCCGTTCGTCGAAAGG
CGGCACGGCAGGCAACGAAATCCGCATGGAGGACAAGCTCAATTCCGAGGAGCTGTATGTCCATGCGCAG
AAGGACATGAGCGTCGAGATCGAAAACGCGCTCTCCACCACCGTCAAGGCGGGCGCGGAAACGCACGTGG
TGCTGAAAGGCGATCGCAGCGTCGAGGTGAGCGAGGGCAAGGAGACGCACACCGTCAAAGGCACACGTAC
GCTCGACGTGACAGGCGATGAAACGCATACCAACCATGCGGCGTTTGCGCACAACGTCAGCGGCAATCAC
ACCCACAAGATCGACGGCAATTACACATTGAAGGTAGGCGGCAATCTGGTGATCGAAGTCAGTGGCTCGA
TCAGCATCAAGGCGGGCACGTCGTTGTCCAGCGAAGCGGGCACGTCGCACGCGAGCAAGGCGGGGACGAC
GCTCAGCAGCGAAGGCATGACAGTTTCGCATAAGGCCTCGGCCACGCAGACTGTCGATGGCGGCGGTCAG
CTCGCCCTCAAGGGCGGCATCGTCCAGCTCAACTGA
 Primer design