SecReT6
Protein ID: 186470785
SecReT6 ID274
T6SS typei4a
Gene symbol-
Locus tagBphy_5994
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]527884..529218 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDB2JVT0
KEGG IDbph:Bphy_5994
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-72, Aligned region: 25..428
Protein Sequence: 444 a.a.     [Download]
>gi|186470785|ref|YP_001862103.1| unnamed protein product [Burkholderia phymatum STM815]
MMHDANMAVTDRIEWFEGMLLSPQHFQQMASRVDSLVAWQTLAAAPFSWGVRRLVLDHGLLPAGLLRVLE
LDAIMPDGTAVTYSAEAQGAVRLELSLEPFAASLTSGPIDFYLVLPVAGTMRRSAQVKRFRSSAGMPVED
QVSDAPPADIPRLMPNLALAAGELPSAMHVYLRLGSLYRDNEVVRLGEHLPPLLEVARDNPLWTSVASLL
GQLRGKAAFVARQTANPSSKVDDRLTQLELKDRLRSLLSALPLAEAVLRTPHLHPLSLYLSLASLNGSLA
MLKPGGLPPVPPDYDHADPLSVFTPLLRSLRESMSEVNEAYREHKFEFRHGAFEIALHPDWIGERLVVGL
RGQSDRDLLAWMDGAVIGSQSVYASLRSRRVLGAARRGIDYAEDLGLRSGSGYLLFEVEAEHALVLASEL
LVIGNPNEGASAQRPQEMLLFVKG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|186470346|ref|NC_010625.1|:527884-529218 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGATGCATGACGCCAACATGGCGGTGACCGACCGTATCGAATGGTTTGAAGGCATGCTGCTCTCGCCGC
AGCATTTCCAGCAAATGGCGTCGCGTGTCGATTCGCTCGTGGCCTGGCAGACGCTTGCCGCCGCGCCGTT
CAGCTGGGGCGTCCGGCGTCTGGTGTTGGACCACGGTCTGCTCCCCGCGGGTCTGCTGCGCGTGCTCGAA
CTCGACGCGATCATGCCCGACGGCACGGCTGTGACGTATAGCGCCGAAGCGCAAGGCGCAGTGCGCCTTG
AACTGTCGCTCGAACCCTTTGCGGCATCGCTCACGAGCGGGCCGATCGATTTCTATCTTGTCCTGCCCGT
CGCGGGCACGATGCGCCGCAGCGCCCAGGTCAAACGCTTCCGTTCGAGTGCGGGTATGCCCGTCGAGGAT
CAGGTCTCTGACGCACCGCCCGCCGATATCCCTCGCCTCATGCCGAATCTCGCGCTTGCCGCGGGCGAAT
TGCCGTCGGCCATGCATGTCTACCTGCGCCTCGGCTCGCTATACAGGGACAATGAGGTCGTACGGCTCGG
CGAGCATTTGCCACCGTTGCTGGAAGTGGCGCGCGACAATCCGCTGTGGACAAGCGTCGCGTCCCTGCTT
GGGCAACTGCGCGGCAAGGCGGCGTTCGTCGCGCGGCAGACTGCGAATCCTTCGTCGAAGGTCGACGATC
GCCTGACGCAACTCGAACTCAAGGACCGGCTGCGCAGCCTGCTGAGCGCGCTGCCGCTCGCAGAAGCCGT
GCTGCGCACACCGCATCTTCATCCGCTGTCGCTCTATCTGTCGCTGGCGTCGCTTAACGGATCGCTCGCG
ATGCTCAAGCCGGGTGGCCTGCCGCCCGTGCCGCCCGACTACGATCACGCGGACCCGCTTTCTGTGTTCA
CGCCGCTGTTGCGTTCGCTGCGCGAATCGATGTCGGAAGTCAACGAAGCGTATCGCGAGCACAAGTTCGA
ATTCCGCCACGGGGCCTTCGAAATCGCGCTGCATCCGGACTGGATCGGCGAGCGTCTGGTGGTCGGCCTG
CGCGGTCAGTCGGATCGCGACCTGCTGGCGTGGATGGATGGCGCCGTCATCGGTTCTCAATCGGTCTATG
CGTCGTTGCGCAGCCGCCGCGTGCTGGGCGCCGCGCGCCGCGGGATCGACTATGCCGAGGATCTCGGCCT
GCGTTCGGGCTCGGGGTATCTGCTCTTCGAAGTCGAGGCCGAGCACGCGCTGGTGCTGGCGAGCGAACTG
CTGGTGATCGGCAACCCCAACGAGGGCGCGAGCGCGCAGCGGCCACAGGAAATGCTGCTGTTCGTGAAGG
GATGA
 Primer design