SecReT6
Protein ID: 186470786
SecReT6 ID274
T6SS typei4a
Gene symbol-
Locus tagBphy_5995
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]529280..530032 [+]
Producthypothetical protein
NoteTssL
UniProt IDB2JVT1
KEGG IDbph:Bphy_5995
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-38, Aligned region: 18..234
Protein Sequence: 250 a.a.     [Download]
>gi|186470786|ref|YP_001862104.1| unnamed protein product [Burkholderia phymatum STM815]
MARNRPEPEEDDLVTEQFRTFLDELVRAQTRFSGLPDADPDLAAQSMSRHLLDLLEIQTLQSRRDSTRFE
METIADARYLKAVLADEILLNSPWAGREHWTGYLLESTLFRTNVAGDQIFRRIEQLLSDREPSYRNIARL
YLFALAMGFQGRFRDTDATARLRSYREELYEFVYQRRPDLGGRERVLSEPAYGNTLSHVAPRKLPTVSRW
AVILMLAAVSLLAISEMLWLWQSWPVRDALHADPVTGRSS
 
Nucleotide Sequence: 753 bp     [Download]
>gi|186470346|ref|NC_010625.1|:529280-530032 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGGCACGCAACCGACCCGAACCCGAAGAAGACGATCTTGTGACCGAGCAGTTCCGTACGTTTCTCGACG
AGCTCGTCAGGGCGCAGACGCGATTTTCCGGGTTGCCCGATGCAGACCCGGACCTCGCCGCGCAGAGCAT
GAGTCGCCACCTGCTTGATCTGCTCGAAATCCAGACGCTGCAATCGCGCCGTGACAGCACGCGCTTCGAA
ATGGAGACGATTGCCGACGCCCGCTATCTGAAAGCCGTGCTCGCAGACGAAATCCTGCTCAATTCGCCGT
GGGCGGGACGCGAGCACTGGACGGGCTATCTGCTCGAATCGACGCTGTTTCGCACCAACGTCGCCGGAGA
TCAGATCTTTCGCCGTATCGAGCAATTGCTGTCGGACCGCGAACCTTCATATCGCAATATCGCGCGGCTC
TACCTGTTCGCGCTGGCGATGGGCTTCCAGGGCCGCTTTCGCGACACCGATGCCACGGCGCGTCTGCGCA
GCTATCGAGAGGAACTCTACGAGTTCGTCTATCAGCGCCGCCCCGATCTTGGGGGGCGCGAGCGCGTGCT
GTCCGAGCCCGCCTATGGCAACACGCTGTCGCACGTTGCTCCGCGCAAGCTGCCGACAGTCAGCCGCTGG
GCCGTGATTCTGATGCTCGCCGCAGTATCACTGCTGGCGATTTCCGAAATGCTGTGGCTGTGGCAATCGT
GGCCCGTACGCGACGCGCTGCATGCCGACCCGGTGACGGGGAGAAGTTCATGA
 Primer design