SecReT6
Protein ID: 186470787
SecReT6 ID274
T6SS typei4a
Gene symbol-
Locus tagBphy_5996
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]530121..534299 [+]
ProductIcmF-like protein
NoteTssM
UniProt IDB2JVT2
KEGG IDbph:Bphy_5996
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.80E-40, Aligned region: 138..431
ImcF-related_N [PF14331], Evalue: 7.80E-40, Aligned region: 1095..1132
Protein Sequence: 1392 a.a.     [Download]
>gi|186470787|ref|YP_001862105.1| unnamed protein product [Burkholderia phymatum STM815]
MLTSNLFLLSIALLTLVVCAVLGAVLYFAIHGSHAKPQTERKIVRLRSDSLRSAFRQAVELIEGNIASRA
ERYNIPWIMILNEGDDPRPLPIAQAGVASVLGAEAASSAATQGISWHFFDRGIVVDIKAAYLGSPDDDGD
GKPWDEFLGLCRNYRQQRPFDSVVITVPAATLLADNTDARLELVRHAKLAHRRLWLAQNRFAMRFAVYVV
ITGCEALPGFPTFARALPEPMRASMLGWSSPYDLSTTYQPDWVDTAMNSVMRSVSDVSAELFALDSAHLD
ARQFLQLPSRIDAMRAQLQLYVDELLRASAYHEPFFFRGIYLTGDASEFAQWSAAQGGEAAQPGALPSPA
DARRDSVMPYAGASGTEEHTDLALGDGGREPGGAINDLMLQPAFLRDLFEKKIFLEYGLTRPSRSQHLTR
PVMSRALRWGSIALLGGWGMGLVVATVQLSHRNGELVTALGSLRRDTGERAAALQQGQDLPADWYRRKAL
ALIVLNQHLRTDSTWTVFMPGSWSIVDDLNARVKERFEREFGEIAVAALEREMYARVSQLTGVGRDPSTG
QLIAGDDCAAPGGMRADAGAAPSLAVDDLPEMRSLQLYVNNVDRFDAALQALQRLQHPAADNADALRLVV
RYALGAELQGSVSGSLPYFYREQSGVAARTSGIDLVPVQQALRCTLNKGAQQLDNGLFTNNPLLVAERTV
TDNLNTLSVSDSGTGDFSKLTAGYRAIVAGIDAQRDLLASGKGSWLHQPQFMPGPAYDHTLSRVAQNRLL
GADLAAQIRQRDDTEFQAFRSELALRFGGATSGIVWADKDARYSVSPERTALRDGLSNLLNQPFMVAPRN
RELPTLADGSTIAWDRAQLDQALALGDVRKHFLTDGMTNMPAAIRPMIEDALDLQFARLILDQTAAAATV
TAAQGDPDSAAFDAARVRLTRIEALLMELGATAQLEELGMLVSADAIAHLQRVDNALTQSELYATRQDGG
NEGQHGGRSPVLAAFGVADGAGLAAYLDQQAARAVSLGKQASVYLSALDAASATAPLVQRWQAINRDLER
YQLKNPNSSLLRLEQFALSVAADPGPAGCMSKFTARPATNGDGDYFAMLHARLYDRLLARCSQSYVSDLR
QRWASFASEFNETVAGRQPFDNSNMVRVGTRADVGSADFGELGQVLKRYAPVSEAFHAARGSAIAQAGAA
GVAGGKLRQFIDNFDQVRTLLAPLYPSDDGAPNGYELSVEFRANRVGEIAANQVIDWTLTIGSQSLSMNE
APRTLHWDYGTPVSLALRFAKDSPLTAMSDPQQRALSTDGRTLTWQFTDPWALISFINRQRVTDASPRAD
NAAQLLKFDFPLSTVDPANLSLLPKQAHGRVFVRLALMPAGKKTPLPWPGSFPVRAPDWTAL
 
Nucleotide Sequence: 4179 bp     [Download]
>gi|186470346|ref|NC_010625.1|:530121-534299 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGCTGACGAGCAATCTGTTTCTGCTTTCCATTGCGCTGCTGACGCTGGTGGTCTGCGCCGTGCTGGGTG
CCGTGCTGTATTTCGCGATCCACGGTTCGCACGCGAAGCCGCAAACCGAGCGCAAGATCGTGCGTTTGCG
CTCGGACTCGTTGCGTAGCGCTTTTCGCCAGGCCGTCGAGCTGATCGAAGGCAATATCGCGTCGCGCGCC
GAGCGCTACAACATTCCGTGGATCATGATCCTCAATGAAGGGGACGACCCGCGTCCGCTGCCGATTGCTC
AGGCGGGCGTCGCCAGCGTGCTGGGTGCCGAGGCGGCGAGCTCGGCCGCCACGCAAGGCATCTCATGGCA
CTTCTTCGATCGGGGGATTGTGGTCGATATCAAGGCGGCCTATCTCGGTTCGCCCGATGACGATGGCGAC
GGCAAGCCGTGGGACGAGTTTCTCGGTTTATGTCGCAACTACCGCCAGCAGCGCCCGTTCGATTCCGTCG
TGATCACGGTGCCGGCTGCCACGCTGCTCGCCGATAACACCGACGCGCGCCTTGAACTCGTGCGTCACGC
GAAGCTCGCGCACCGCCGGTTGTGGCTTGCGCAGAACCGTTTCGCAATGCGCTTTGCTGTGTACGTGGTC
ATCACCGGCTGCGAAGCGTTGCCCGGCTTCCCGACCTTCGCGCGCGCGCTCCCTGAGCCGATGCGCGCCA
GCATGCTGGGCTGGTCGTCGCCGTACGATCTTTCGACGACCTATCAGCCCGACTGGGTCGACACGGCGAT
GAACAGCGTGATGCGCTCCGTGTCCGACGTAAGCGCCGAACTCTTCGCACTCGATTCGGCGCATCTCGAC
GCGCGGCAGTTCCTGCAATTGCCCTCCCGCATCGACGCGATGCGCGCGCAACTGCAGCTCTATGTGGATG
AGCTGCTGCGCGCGAGCGCATACCACGAACCGTTCTTTTTTCGCGGCATCTACCTGACGGGGGACGCAAG
CGAATTCGCGCAATGGAGCGCCGCGCAGGGCGGCGAAGCGGCGCAACCCGGCGCGTTGCCATCACCCGCC
GATGCCCGGCGCGACAGCGTGATGCCTTATGCGGGCGCCAGCGGAACCGAAGAACATACCGATCTCGCCC
TCGGCGATGGCGGGAGGGAGCCGGGCGGCGCGATCAACGACCTGATGTTGCAGCCGGCATTCCTGCGCGA
TCTCTTCGAGAAGAAAATCTTCCTTGAATACGGCCTGACGCGTCCATCGCGTTCGCAGCATCTGACGCGT
CCCGTGATGAGCCGCGCGCTGCGCTGGGGCAGCATCGCGCTGCTGGGCGGCTGGGGCATGGGTCTCGTCG
TCGCAACCGTGCAACTGAGCCATCGCAATGGCGAGCTTGTCACCGCGCTCGGCTCGCTGCGCCGCGATAC
CGGCGAGCGCGCTGCGGCCTTGCAGCAAGGGCAGGATTTGCCCGCTGACTGGTATCGCCGCAAGGCGCTC
GCGCTCATCGTACTGAACCAGCATCTGAGAACTGACAGCACGTGGACGGTTTTCATGCCGGGCTCGTGGA
GCATTGTCGATGACCTCAATGCACGCGTGAAAGAGCGTTTCGAGCGCGAGTTCGGCGAAATCGCTGTTGC
GGCGCTCGAACGCGAAATGTACGCACGGGTTAGTCAGCTGACGGGAGTGGGGCGCGATCCGAGCACCGGC
CAGCTGATTGCGGGCGATGACTGTGCGGCGCCGGGCGGCATGCGCGCCGATGCTGGCGCTGCGCCGAGTC
TCGCCGTCGACGATCTTCCCGAGATGCGTTCGCTGCAGCTCTACGTGAACAACGTCGATCGATTCGATGC
CGCGTTGCAGGCGCTGCAGAGGCTCCAGCACCCGGCGGCAGACAACGCCGATGCATTGCGCCTCGTGGTG
CGTTACGCGCTCGGCGCGGAATTGCAGGGAAGCGTGTCTGGAAGCCTGCCTTACTTCTATCGCGAGCAAA
GCGGTGTGGCGGCGCGCACGTCGGGCATCGATCTTGTACCTGTGCAGCAGGCGTTGCGCTGTACGCTGAA
CAAGGGCGCTCAGCAACTCGACAACGGACTCTTCACGAACAACCCGCTGCTGGTTGCCGAGCGCACGGTG
ACCGATAACCTCAACACGCTTTCGGTGTCGGACTCGGGTACTGGCGACTTTTCGAAGCTCACCGCGGGCT
ATCGCGCGATCGTGGCGGGTATCGATGCACAGCGCGATTTGCTCGCATCGGGCAAGGGCAGCTGGCTCCA
TCAGCCGCAATTCATGCCGGGGCCCGCGTATGACCACACGCTTTCGCGCGTGGCTCAAAACCGCCTGCTT
GGCGCAGATCTCGCGGCACAGATCCGGCAGCGGGACGACACGGAATTTCAGGCGTTTCGCAGCGAACTGG
CGCTGCGTTTCGGTGGGGCCACCAGCGGCATCGTCTGGGCCGACAAGGACGCGCGCTATAGCGTTTCGCC
CGAGCGCACTGCGTTGCGCGATGGACTGTCGAATCTGCTGAACCAACCGTTCATGGTGGCGCCGCGCAAT
CGTGAACTGCCGACGCTCGCCGATGGTTCGACGATCGCCTGGGATCGTGCGCAACTCGACCAGGCGCTCG
CGCTCGGCGACGTGCGCAAGCACTTCCTGACGGATGGCATGACTAACATGCCTGCCGCGATACGTCCCAT
GATCGAAGATGCGCTCGATCTCCAGTTTGCGCGCCTGATCCTCGATCAGACAGCGGCGGCGGCAACCGTG
ACGGCGGCGCAAGGCGATCCGGACAGCGCGGCGTTCGACGCGGCACGCGTGCGGCTCACGCGAATCGAGG
CGCTTCTGATGGAGCTGGGCGCGACCGCGCAACTCGAAGAACTCGGAATGCTCGTGTCGGCGGATGCAAT
CGCGCATTTGCAGCGGGTGGACAACGCGCTCACGCAGTCCGAACTCTATGCGACGCGCCAGGACGGCGGC
AACGAGGGCCAGCATGGCGGACGCTCGCCCGTGCTCGCGGCATTTGGAGTTGCGGATGGGGCCGGGCTCG
CGGCGTATCTGGATCAGCAGGCAGCGCGCGCGGTGTCGCTCGGAAAACAGGCTTCCGTGTATCTGTCGGC
ACTTGACGCTGCCAGCGCAACAGCGCCCCTTGTGCAGCGCTGGCAGGCGATCAACCGCGATCTCGAACGC
TATCAGCTCAAGAATCCGAATAGCAGTCTGCTGCGCCTCGAGCAGTTCGCGCTATCAGTAGCGGCCGATC
CGGGACCGGCGGGCTGCATGTCGAAGTTCACGGCTCGACCGGCTACCAATGGCGACGGCGACTACTTCGC
GATGCTGCACGCCCGGCTCTATGACCGGCTGCTCGCGCGTTGCAGTCAGTCTTACGTATCCGATTTGCGG
CAGCGATGGGCGAGTTTCGCCAGCGAGTTCAACGAAACCGTGGCAGGGCGTCAGCCGTTCGACAACAGCA
ACATGGTGCGTGTCGGCACGCGCGCCGACGTGGGCTCGGCTGACTTCGGCGAACTCGGTCAGGTGCTCAA
GCGCTACGCGCCTGTATCGGAGGCATTCCACGCAGCGCGCGGCAGCGCCATCGCGCAGGCGGGCGCGGCC
GGTGTTGCGGGCGGCAAGCTGCGCCAGTTCATCGATAACTTCGATCAGGTCAGAACGCTGCTCGCGCCGT
TGTACCCGTCTGATGACGGCGCGCCGAACGGCTACGAGCTGAGTGTCGAGTTTCGCGCTAACCGCGTGGG
CGAGATAGCGGCCAATCAGGTGATCGACTGGACGCTGACGATCGGCTCGCAGAGCCTGTCGATGAACGAA
GCGCCGCGCACGCTGCACTGGGATTACGGCACGCCCGTCTCGCTCGCATTGCGATTCGCGAAAGACTCGC
CACTCACAGCAATGTCCGACCCGCAGCAGCGCGCACTCTCGACGGACGGCCGCACGCTCACATGGCAGTT
CACAGACCCGTGGGCGTTGATCTCGTTCATCAATCGCCAGCGTGTGACTGACGCGAGCCCGCGTGCAGAC
AATGCGGCGCAGTTGCTGAAGTTCGACTTCCCGCTTTCTACCGTCGATCCCGCGAATCTCAGCCTGTTGC
CCAAGCAGGCGCACGGACGCGTGTTCGTGCGCCTGGCACTCATGCCGGCGGGCAAGAAAACACCGCTGCC
GTGGCCCGGCAGCTTCCCGGTGCGCGCACCGGACTGGACCGCGCTATGA
 Primer design